Recombinant Panax ginseng Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Panax ginseng Cytochrome b6-f Complex Subunit 4 (petD)

Panax ginseng, a plant known for its medicinal properties, has been found to contain a Cytochrome b6-f complex. Cytochrome b6-f complex is pivotal in both linear and cyclic electron transport during oxygenic photosynthesis in plants and cyanobacteria . Within this complex, subunit 4, also known as petD, plays a crucial role . "Recombinant" indicates that this subunit has been produced using recombinant DNA technology, involving the insertion of the petD gene into a host organism for expression and production .

Function and Significance of Cytochrome b6-f Complex Subunit 4 (petD)

The cytochrome b6-f complex is essential for photosynthetic electron transfer . It mediates the transfer of electrons between Photosystem II and Photosystem I, contributing to the generation of a proton gradient that drives ATP synthesis . Subunit 4 (petD) is one of the smaller subunits unique to oxygenic photosynthesis, though its precise function remains under investigation . Studies on cyanobacteria suggest that the absence of petN, another small subunit, destabilizes the entire cytochrome b6-f complex, which reduces photosynthetic efficiency .

Role of Panax ginseng Extracts on Cytochrome P450

Panax ginseng extracts can influence the cytochrome P450 system, which is important for drug metabolism . Research indicates that Panax ginseng extracts can inhibit the increase in cytochrome P450 content induced by certain treatments . These extracts might act as inhibitors of specific CYP isozymes, suggesting a potential interaction with drug metabolism pathways .

Impact of Ginsenosides on Hepatic Lipid Metabolism

Ginsenosides, the main active components in Panax ginseng, have demonstrated potential in improving hepatic lipid metabolism disorders . Studies have shown that ginsenosides can reduce body weight, liver weight, and hepatic steatosis in rats fed a high-fat diet . These compounds also modulate gut microbiota composition and regulate the expression of hepatic genes involved in cholesterol metabolism .

Effects of Water-Soluble Ginseng Polysaccharides (WGP) on Complement Component 4 (C4) Biosynthesis

Water-soluble ginseng polysaccharides (WGP) extracted from Panax ginseng have been found to enhance complement component 4 (C4) biosynthesis in human hepatocytes . C4 is a core component of the complement system, which is part of the immune system . WGP treatment significantly increased the mRNA and protein levels of C4, suggesting that WGP promotes C4 biosynthesis by upregulating transcription .

Panax ginseng as an Adaptogen

Panax ginseng is considered an adaptogen, which means it contains natural substances believed to increase the body's resistance to stressors . It has been used in traditional Chinese medicine for thousands of years to treat weakness and fatigue . The adaptogenic properties of Panax ginseng are attributed to ginsenosides, which affect the hypothalamus-pituitary-adrenal axis and the immune system .

Interactions with Medications

Panax ginseng may interact with certain medications that are metabolized by the liver's cytochrome P450 system . It can alter the rate at which the liver breaks down these medications, potentially affecting their efficacy and side effects . Therefore, caution is advised when taking Panax ginseng with drugs like midazolam and selegiline .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
petD; PSC0784; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex subunit 4 (petD) in Panax ginseng?

Cytochrome b6-f complex subunit 4 (petD) is a 160 amino acid protein encoded by the petD gene in the chloroplast genome of Panax ginseng. According to the amino acid sequence data, it contains a transmembrane domain and functions as part of the electron transport chain in photosynthesis . The protein has a molecular structure that includes hydrophobic regions that anchor it within the thylakoid membrane, facilitating its role in electron transfer between photosystem II and photosystem I.

How is recombinant petD protein produced for research purposes?

The production of recombinant petD protein typically involves several methodological steps:

  • Gene isolation: The petD gene is isolated from Panax ginseng chloroplast DNA using specific primers designed for the gene .

  • Vector construction: The gene is cloned into an expression vector such as pET-30a, similar to the methodology used for other Panax ginseng proteins .

  • Host transformation: The recombinant plasmid is transformed into an expression host, commonly E. coli Rosetta strain, which is optimized for expression of plant proteins .

  • Induction and expression: Protein expression is induced using IPTG or similar inducers.

  • Purification: The expressed protein is purified using affinity chromatography, typically via a histidine tag incorporated into the recombinant construct .

What are the optimal storage conditions for recombinant petD protein?

Based on established protocols for similar recombinant proteins from Panax ginseng, the optimal storage conditions for recombinant petD protein are:

  • Short-term storage: 4°C for up to one week in appropriate buffer

  • Long-term storage: -20°C in Tris-based buffer with 50% glycerol

  • Extended storage: -80°C to prevent protein degradation and maintain activity

  • Avoid repeated freeze-thaw cycles which can compromise protein structure and function

How does the petD protein interact with other components of the chloroplast electron transport chain?

The petD protein functions as part of the Cytochrome b6-f complex, which serves as an intermediate electron carrier between photosystem II and photosystem I. Research methodologies to study these interactions include:

  • Co-immunoprecipitation assays: Using antibodies against petD to pull down interaction partners

  • Yeast two-hybrid screening: Identifying protein-protein interactions

  • Blue native PAGE: Preserving protein complexes for analysis

  • Cryo-electron microscopy: Visualizing the structural arrangement of the entire complex

The protein contains specific domains that facilitate interaction with other subunits of the Cytochrome b6-f complex. The N-terminal region (positions 1-40) appears to be involved in complex assembly, while the hydrophobic regions form transmembrane helices that anchor the protein in the thylakoid membrane .

What are the genetic variations of petD across different Panax species and what are their functional implications?

Researching genetic variations requires several methodological approaches:

  • Comparative genomic analysis: The complete chloroplast genome sequence of Korean ginseng (Panax schinseng Nees) reveals specific structural features of the petD gene .

  • Multiple sequence alignment: Comparing petD sequences from different Panax species to identify conserved and variable regions.

  • Site-directed mutagenesis: Testing the functional significance of specific amino acid residues.

  • Phylogenetic analysis: Understanding evolutionary relationships and selection pressures.

Research has identified four short inversions in the chloroplast genomes between Panax schinseng and Nicotiana tabacum that form distinct stem-loop hairpin structures, indicating potential functional adaptations in the petD gene region .

What role might petD play in the biosynthetic pathways of ginsenosides?

While direct evidence linking petD to ginsenoside biosynthesis is limited, several research approaches can help explore this relationship:

  • Gene silencing experiments: Using RNAi or CRISPR to reduce petD expression and measure effects on ginsenoside production

  • Metabolic flux analysis: Tracing carbon flow from photosynthesis to ginsenoside biosynthesis

  • Transcriptome correlation studies: Examining co-expression patterns between petD and known ginsenoside biosynthesis genes

What are the challenges in heterologous expression and purification of functional petD protein?

Researchers face several methodological challenges when working with recombinant petD:

  • Codon optimization: Plant chloroplast genes often require codon optimization for efficient expression in bacterial systems

  • Protein solubility: As a membrane protein, petD tends to form inclusion bodies when overexpressed

  • Refolding protocols:

    • Gradual removal of denaturants (8M urea or 6M guanidine-HCl)

    • Use of detergents (0.1-1% DDM or LDAO)

    • Addition of lipids during refolding

  • Activity assays: Developing assays to confirm proper folding and function

  • Scale-up limitations: Difficulty in producing large quantities of functional protein

A systematic approach to optimization involves testing multiple expression constructs with various solubility tags (MBP, SUMO, TrxA) and expression conditions (temperature, induction time, media composition) .

What methods can be used to study the structure-function relationship of petD protein?

Several advanced methodological approaches can be used:

  • X-ray crystallography: Although challenging for membrane proteins, this method provides high-resolution structural data

  • Circular dichroism spectroscopy: Measures secondary structure content (α-helices, β-sheets)

  • Site-directed mutagenesis workflow:

    • Identify conserved residues through sequence alignment

    • Create point mutations using PCR-based techniques

    • Express and purify mutant proteins

    • Analyze functional changes using activity assays

  • Molecular dynamics simulations: Predicting protein movement and ligand interactions

Investigating the four transmembrane helices and their orientation in the membrane is crucial for understanding petD function in electron transport .

What is the most effective protocol for extracting and purifying native petD from Panax ginseng tissue?

The extraction and purification of native petD protein requires specialized techniques for membrane proteins:

  • Tissue preparation:

    • Fresh young leaves provide the highest chloroplast content

    • Homogenize in buffer containing 330 mM sorbitol, 50 mM HEPES (pH 7.8), 2 mM EDTA

    • Include protease inhibitors (1 mM PMSF, 5 mM benzamidine)

  • Chloroplast isolation:

    • Differential centrifugation (1,000 × g for 5 min, then 10,000 × g for 15 min)

    • Purify through Percoll gradient centrifugation

  • Thylakoid membrane extraction:

    • Osmotic shock in hypotonic buffer

    • Recover membranes by centrifugation (15,000 × g for 20 min)

  • Protein solubilization:

    • Solubilize with 1% n-dodecyl β-D-maltoside

    • Incubate at 4°C with gentle rocking for 1 hour

  • Purification strategy:

    • Ion exchange chromatography (DEAE-Sepharose)

    • Size exclusion chromatography

    • Immunoaffinity purification using specific antibodies

The yield is typically low (0.1-0.2 mg per 100 g fresh tissue) due to the challenges of membrane protein purification .

How can researchers design effective heterologous expression systems for functional studies of petD?

Designing effective heterologous expression systems requires careful consideration of multiple factors:

  • Vector selection criteria:

    • Strong but controllable promoter (T7, tac)

    • Appropriate tags for purification and solubility enhancement

    • Compatible with membrane protein expression

  • Expression host optimization:

    • E. coli C41(DE3) or C43(DE3) strains designed for membrane proteins

    • Rosetta strain to address codon bias issues

    • Lower temperature cultivation (16-20°C)

    • Slower induction (0.1-0.5 mM IPTG)

  • Expression validation methods:

    • Western blotting

    • GFP fusion for real-time monitoring

    • Small-scale expression tests

  • Purification strategy:

    StepMethodBuffer CompositionExpected Outcome
    LysisFrench Press/Sonication50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerolCell disruption
    Membrane isolationUltracentrifugationSame as lysis bufferMembrane fraction
    SolubilizationDetergent treatmentLysis buffer + 1% DDMSolubilized protein
    Affinity purificationNi-NTAAbove + 20-250 mM imidazole gradient~80% pure protein
    Size exclusionSuperdex 20025 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM>95% pure protein
  • Functional reconstitution:

    • Incorporation into liposomes or nanodiscs

    • Electron transport activity assays using artificial electron donors/acceptors

What techniques can be used to determine the role of petD in photosynthetic efficiency in Panax ginseng?

Several methodological approaches can assess petD's role in photosynthesis:

  • Chlorophyll fluorescence measurements:

    • Pulse-amplitude modulation (PAM) fluorometry

    • Fast chlorophyll fluorescence induction kinetics

    • Parameters to measure: Fv/Fm, ΦPSII, NPQ, ETR

  • Oxygen evolution measurements:

    • Clark-type electrode

    • Membrane inlet mass spectrometry

    • Light response curves at different wavelengths

  • Spectroscopic analysis:

    • P700 redox kinetics (measuring PSI activity)

    • Cytochrome f redox changes (direct measurement of Cyt b6-f activity)

    • Absorption spectroscopy to track electron flow

  • Genetic approaches:

    • CRISPR-Cas9 mutagenesis of the petD gene

    • RNA interference to reduce expression

    • Complementation studies with wild-type or modified petD genes

  • Physiological measurements:

    • CO2 assimilation rates

    • Stomatal conductance

    • Growth rates and biomass accumulation

    • Adaptation to different light conditions

How can researchers study the potential relationship between petD function and ginsenoside biosynthesis?

Investigating this relationship requires integrative approaches:

  • Transcriptome analysis:

    • RNA-Seq of tissues with varying ginsenoside content

    • Co-expression network analysis between petD and ginsenoside biosynthetic genes

    • qRT-PCR validation of key correlations

  • Metabolic engineering approaches:

    • Modulation of petD expression and measurement of ginsenoside content

    • Carbon flux analysis using isotope labeling

    • Measurement of energy status (ATP/ADP ratio) and reducing power (NADPH/NADP+ ratio)

  • Chloroplast isolation and manipulation:

    • Isolated chloroplast incubation with precursors

    • In organello protein synthesis assays

    • Measurement of intermediate metabolites

  • Correlation studies:

    • Comparative analysis of petD sequence/expression and ginsenoside profiles across different Panax species or cultivars

    • Analysis under different environmental conditions affecting both photosynthesis and secondary metabolism

What analytical methods are most effective for detecting structural changes in petD protein under different experimental conditions?

Multiple complementary techniques provide insights into structural changes:

  • Spectroscopic methods:

    • Circular dichroism (CD) spectroscopy: Measures changes in secondary structure

    • Fluorescence spectroscopy: Monitors changes in environment around tryptophan residues

    • FTIR spectroscopy: Detects changes in protein backbone conformation

  • Biophysical techniques:

    • Differential scanning calorimetry (DSC): Measures thermal stability

    • Isothermal titration calorimetry (ITC): Quantifies binding interactions

    • Surface plasmon resonance (SPR): Real-time binding kinetics

  • Structural biology approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps solvent-accessible regions

    • Limited proteolysis: Identifies flexible or exposed regions

    • Cross-linking mass spectrometry: Captures spatial relationships

  • Computational methods:

    • Molecular dynamics simulations

    • Homology modeling

    • Protein stability predictions

These methods in combination can reveal how experimental conditions affect petD structure and function, informing research on its role in Panax ginseng metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.