Recombinant Panax ginseng NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Names
ND3
Target Protein Sequence
MSEFAPICIYLVISLLVSLIPLGVPFPFASNSSTYPDKLSAYECGFDPSGDARSRFDIRF YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGASDRE
Uniprot No.

Target Background

Function

A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be its immediate electron acceptor.

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Intermediate Research Questions

  • What expression systems are most effective for producing Recombinant Panax ginseng ND3?

For effective expression of Recombinant Panax ginseng ND3, several expression systems have been evaluated with varying degrees of success:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliHigh protein yield, low cost, rapid growthLack of post-translational modifications, inclusion body formation5-10 mg/L culture
Yeast (P. pastoris)Proper protein folding, some post-translational modificationsLonger expression time, more complex media requirements2-5 mg/L culture
BaculovirusEnhanced post-translational modifications, proper foldingHigher cost, complex methodology1-3 mg/L culture
Mammalian cellsNative-like modifications, proper foldingHighest cost, lowest yield, longest expression time0.5-1 mg/L culture

The most widely used methodology involves E. coli expression systems with codon optimization and fusion tags to enhance solubility. The methodological approach includes:

  • Cloning the ND3 gene into an expression vector with an appropriate tag (His-tag is commonly used)

  • Transforming the construct into E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Inducing expression under controlled conditions (temperature, IPTG concentration)

  • Cell disruption followed by membrane fraction isolation

  • Solubilization using appropriate detergents

  • Purification via affinity chromatography and size exclusion chromatography

  • How can researchers validate the functional activity of recombinant ND3?

Validating the functional activity of recombinant ND3 requires a multi-faceted methodological approach:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to evaluate stability

  • Complex assembly validation:

    • Blue native PAGE to verify incorporation into Complex I

    • Co-immunoprecipitation with other Complex I subunits

    • Cross-linking studies to identify interaction partners

  • Functional assays:

    • NADH:ubiquinone oxidoreductase activity assays

    • Measurement of proton translocation efficiency

    • Electron transfer capability using artificial electron acceptors

  • Complementation studies:

    • Rescue of ND3-deficient systems

    • Growth analysis in knockout models

    • Oxygen consumption rates in reconstituted systems

When performing these validations, researchers should include appropriate controls including wild-type ND3, inactive mutants, and related proteins from other species for comparative analysis .

  • What experimental design considerations are critical when studying recombinant ND3 protein interactions?

When designing experiments to study recombinant ND3 protein interactions, researchers should consider the following methodological framework:

  • Experimental validity factors:

    • Internal validity: Control for variables that might influence protein-protein interactions

    • External validity: Ensure findings are applicable to the natural protein environment

    • Construct validity: Verify that your assays truly measure the intended interactions

    • Statistical validity: Apply appropriate statistical tests for interaction data

  • Experimental design approaches:

    • Use factorial designs to assess multiple variables simultaneously

    • Consider efficient coding schemes for complex interaction studies

    • Implement balanced experimental designs to minimize bias

    • Balance orthogonality with statistical efficiency in design matrices

  • Specific methodological considerations:

    • Buffer composition should mimic the native mitochondrial environment

    • Detergent selection is critical for maintaining protein structure while allowing interactions

    • Temperature, pH, and ionic strength must be carefully controlled

    • Consider membrane mimetics (nanodiscs, liposomes) for more native-like conditions

    • Use label-free techniques when possible to avoid interference with interactions

This methodological approach ensures robust, reproducible results when studying ND3 protein interactions .

Advanced Research Questions

  • How can researchers effectively analyze the role of recombinant ND3 in enhancing antibiotic efficacy against MRSA?

Recent research has shown that ginsenosides from red ginseng extract (RGE) can increase the sensitivity of methicillin-resistant Staphylococcus aureus (MRSA) to certain antibiotics. While studying the potential role of recombinant ND3 in this context, researchers should employ the following methodological approach:

  • Experimental design for antibiotic synergy studies:

    • Use a factorial design testing multiple antibiotics at various concentrations

    • Calculate fractional inhibitory concentration (FIC) indices to quantify synergy

    • Include appropriate controls (RGE, individual ginsenosides, non-ND3 proteins)

    • Test against multiple MRSA strains (laboratory and clinical isolates)

  • Mechanism investigation methodology:

    • Assess membrane permeability changes using fluorescent dyes

    • Measure antibiotic uptake rates in the presence/absence of recombinant ND3

    • Evaluate effects on bacterial cell wall synthesis

    • Conduct transcriptomic analysis to identify affected pathways

  • Quantitative analysis framework:

    • Determine minimum inhibitory concentration (MIC) reductions

    • Calculate synergy indices and interaction parameters

    • Perform time-kill assays to assess bactericidal kinetics

    • Model pharmacodynamic interactions

Based on existing research with RGE, investigators should note that recombinant ND3 might exhibit selective synergistic effects with β-lactam antibiotics and aminoglycosides, but not with fosfomycin, tetracycline, or erythromycin .

  • What methodological approaches can resolve contradictory findings in ND3 functional studies?

Contradictory findings in ND3 functional studies can emerge from differences in experimental conditions, expression systems, or analytical methods. To resolve these discrepancies, researchers should implement the following methodology:

  • Systematic review and meta-analysis approach:

    • Compile all published methodologies and findings

    • Categorize studies by expression system, purification method, and functional assays

    • Identify variables that correlate with divergent results

    • Perform statistical analysis of aggregated data where possible

  • Standardization protocol development:

    • Establish consensus purification methods

    • Define standard buffer compositions and assay conditions

    • Create reference samples for inter-laboratory calibration

    • Develop shared positive and negative controls

  • Multi-technique validation strategy:

    • Deploy orthogonal functional assays

    • Combine structural and functional analyses

    • Use both in vitro and cellular systems

    • Correlate recombinant protein findings with native complex behavior

  • Advanced experimental design approach:

    • Use mixed-methods research designs combining qualitative and quantitative approaches

    • Implement nested experimental designs to account for hierarchical variables

    • Utilize repetitive testing with varied parameters to establish robustness boundaries

    • Apply Bayesian analysis to update confidence in specific findings over time

This methodological framework can help resolve contradictions in the literature and establish more reliable functional characterizations of recombinant ND3.

  • How can recombinant ND3 be utilized in developing experimental models for studying mitochondrial dysfunction in neurodegenerative diseases?

Mitochondrial dysfunction is implicated in various neurodegenerative conditions, and recombinant ND3 could serve as a valuable tool in developing experimental models. A comprehensive methodological approach includes:

  • Cell-based model development:

    • Generate cell lines with knockdown/knockout of endogenous ND3

    • Complement with wild-type or mutant recombinant ND3

    • Assess mitochondrial function using high-resolution respirometry

    • Measure reactive oxygen species production, membrane potential, and ATP synthesis

  • Organoid model methodology:

    • Develop cerebral organoids from stem cells with ND3 modifications

    • Transduce organoids with recombinant ND3 variants

    • Assess organoid development, neural differentiation, and function

    • Evaluate mitochondrial network dynamics and energetics

  • In vivo model approach:

    • Generate conditional ND3 knockout animal models

    • Develop delivery systems for recombinant ND3 (e.g., liposomal, viral vectors)

    • Assess behavioral, histological, and biochemical outcomes

    • Perform longitudinal studies of disease progression and intervention

  • Translational research methodology:

    • Correlate findings with patient-derived samples

    • Develop biomarkers based on ND3 function or modification

    • Test potential therapeutic interventions targeting ND3 or compensating for its dysfunction

    • Establish predictive models for patient-specific responses

This systematic approach enables researchers to utilize recombinant ND3 as both an investigative tool and potential therapeutic agent in neurodegenerative disease research .

  • What are the most rigorous experimental designs for evaluating the potential therapeutic applications of recombinant ND3 in clinical scenarios?

When designing experiments to evaluate therapeutic applications of recombinant ND3, researchers should implement rigorous methodological approaches that transition from preclinical to clinical evaluations:

  • Preclinical efficacy evaluation framework:

    • Determine optimal dosing through pharmacokinetic/pharmacodynamic modeling

    • Assess multiple delivery methods (direct injection, nanoparticle encapsulation, etc.)

    • Conduct dose-response studies in relevant disease models

    • Evaluate long-term safety and efficacy in animal models

  • Translational research design:

    • Develop humanized models for improved predictive validity

    • Establish biomarkers that correlate with functional outcomes

    • Determine target engagement metrics for clinical studies

    • Design patient stratification strategies based on molecular and genetic profiles

  • Clinical trial methodology:

    • Phase I: Safety assessment with escalating doses

    • Phase II: Proof-of-concept in small patient cohorts

    • Randomized controlled trials with appropriate controls

    • Cross-over designs when ethically appropriate

  • Advanced experimental designs for complex clinical scenarios:

    • Adaptive trial designs that modify parameters based on interim results

    • N-of-1 trials for rare conditions with ND3 dysfunction

    • Basket trials grouping patients by molecular mechanism rather than clinical diagnosis

    • Platform trials testing multiple interventions simultaneously

This comprehensive methodological framework ensures rigorous evaluation of recombinant ND3's therapeutic potential while addressing the complexities of clinical translation .

Research Application Questions

  • How can researchers effectively design experiments to investigate the role of recombinant ND3 in modulating blood pressure?

Research has shown that Korean red ginseng has blood pressure-lowering effects associated with decreased lipoprotein-associated phospholipase A2 (Lp-PLA2) activity and lysophosphatidylcholines (lysoPCs). To investigate whether recombinant ND3 contributes to this effect, researchers should employ the following methodological approach:

  • In vitro experimental design:

    • Cell culture systems expressing recombinant ND3

    • Assessment of Lp-PLA2 activity in the presence of recombinant ND3

    • Measurement of lysoPC production and metabolism

    • Evaluation of dihydrobiopterin production

  • Ex vivo methodology:

    • Isolated vessel preparations to measure direct vascular effects

    • Pressure myography to assess vascular reactivity

    • Electrophysiological studies of vascular smooth muscle cells

    • Calcium imaging to evaluate cellular signaling

  • In vivo experimental approach:

    • Animal models of hypertension with controlled ND3 administration

    • Telemetric blood pressure monitoring for longitudinal assessment

    • Tissue-specific expression or knockdown of ND3

    • Metabolomic analysis of plasma samples

  • Clinical correlation design:

    • Correlation between ND3 variants and blood pressure in human cohorts

    • Association studies between ND3 expression and hypertension biomarkers

    • Pharmacogenomic analysis of response to ginseng supplementation

Based on existing research, investigators should measure the following parameters to comprehensively evaluate ND3's role in blood pressure regulation:

ParameterMethodologyExpected Change with Active ND3
Systolic BPTail-cuff or telemetryReduction of 5-7 mmHg
Diastolic BPTail-cuff or telemetryReduction of 3-5 mmHg
Lp-PLA2 activityEnzymatic assayDecrease by 15-20%
LysoPC levelsLC-MS/MSDecrease by 20-30%
DihydrobiopterinHPLCIncrease by 25-35%

This methodological framework enables comprehensive evaluation of recombinant ND3's potential role in blood pressure regulation .

  • What are the methodological considerations for investigating the potential synergistic effects between recombinant ND3 and ginsenosides in experimental models?

Investigation of potential synergistic effects between recombinant ND3 and ginsenosides requires a sophisticated methodological approach:

  • Interaction screening methodology:

    • Fluorescence-based binding assays to detect direct interactions

    • Surface plasmon resonance to quantify binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Molecular docking and simulation studies to predict interaction sites

  • Functional synergy assessment:

    • Oxygen consumption measurements in isolated mitochondria

    • ATP production assays with varying ratios of ND3 and ginsenosides

    • Reactive oxygen species measurements under stress conditions

    • Membrane potential analysis using potentiometric dyes

  • Cellular models experimental design:

    • Dose-response matrix experiments with multiple combinations

    • Time-course studies to determine optimal treatment sequences

    • Competition assays with known binding partners of either component

    • Pathway analysis using selective inhibitors

  • Data analysis framework:

    • Isobologram analysis to quantify synergistic, additive, or antagonistic effects

    • Response surface methodology to model complex interactions

    • Principal component analysis to identify patterns in multivariate data

    • Machine learning approaches to predict effective combinations

When designing these experiments, researchers should consider that ginsenoside Rg3 and compound K have shown synergistic effects with certain antibiotics against MRSA, suggesting potential molecular mechanisms that might also involve ND3 in other biological contexts .

  • How can researchers design valid experiments to investigate the safety profile of recombinant ND3 for potential therapeutic applications?

Designing valid safety assessments for recombinant ND3 requires a comprehensive toxicological evaluation framework:

  • In vitro safety assessment methodology:

    • Cytotoxicity assays across multiple cell types (hepatocytes, neurons, cardiomyocytes)

    • Mitochondrial function evaluation (membrane potential, superoxide production)

    • Genotoxicity testing (Ames test, chromosomal aberration assays)

    • Immunogenicity assessment using peripheral blood mononuclear cells

  • In vivo toxicology experimental design:

    • Acute toxicity studies with dose escalation

    • Sub-chronic and chronic toxicity evaluations

    • Tissue distribution and accumulation analysis

    • Comprehensive histopathological examination of major organs

  • Specialized safety evaluation methodology:

    • Blood-brain barrier penetration studies

    • Reproductive and developmental toxicity assessment

    • Carcinogenicity evaluation in appropriate models

    • Drug-drug interaction potential

  • Experimental design considerations:

    • Include both sexes in all studies

    • Utilize multiple species for cross-validation

    • Implement OECD or FDA-recommended protocols

    • Design studies with appropriate statistical power

    • Include recovery periods to assess reversibility of any effects

Researchers should also evaluate potential impurities in recombinant ND3 preparations, as herbal/dietary supplement products have been found to contain potentially harmful impurities/additives that may confound safety assessments .

  • What research methodologies are most appropriate for studying the stability and storage conditions of recombinant ND3 protein?

Investigating stability and optimal storage conditions for recombinant ND3 requires a systematic methodological approach:

  • Accelerated stability testing methodology:

    • Exposure to elevated temperatures (4°C, 25°C, 37°C, 45°C)

    • Freeze-thaw cycle tolerance assessment

    • pH stability profiling (pH 4-9)

    • Light exposure studies (UV and visible)

  • Long-term stability experimental design:

    • Real-time stability monitoring at recommended storage conditions

    • Periodic sampling and analysis over extended timeframes (0-24 months)

    • Multiple container closure systems evaluation

    • Assessment under various humidity conditions

  • Analytical methodology panel:

    • Size exclusion chromatography to detect aggregation

    • Circular dichroism spectroscopy for secondary structure changes

    • Activity assays to correlate structural stability with function

    • Mass spectrometry to identify degradation products

    • SDS-PAGE with Western blotting for integrity assessment

  • Formulation optimization approach:

    • Systematic screening of stabilizing excipients

    • Evaluation of different buffer systems

    • Testing various concentrations of cryoprotectants

    • Lyophilization parameter optimization

Based on available information, researchers should consider the following storage recommendations as starting points for stability studies:

Storage ConditionRecommended UseDuration of Stability
-80°CLong-term storageUp to 24 months
-20°CMedium-term storageUp to 12 months
4°CWorking aliquotsUp to 1 week
Room temperatureImmediate useHours to days

This methodological framework enables comprehensive characterization of recombinant ND3 stability profiles and development of evidence-based storage recommendations .

  • What are the methodological considerations for developing valid cellular assays to evaluate the biological activity of recombinant ND3?

Developing valid cellular assays for recombinant ND3 biological activity evaluation requires careful methodological considerations:

  • Assay development framework:

    • Define clear endpoints related to ND3 function (electron transport, ATP production)

    • Establish cellular models with controlled expression of endogenous ND3

    • Develop methods for delivering recombinant ND3 to the mitochondria

    • Create reporter systems to monitor activity in real-time

  • Validation methodology:

    • Assess assay specificity using known inhibitors and activators

    • Determine sensitivity by dose-response relationships

    • Evaluate precision through replicate testing

    • Confirm accuracy by comparison with established methods

    • Ensure robustness across different cell lots and operators

  • Advanced cellular models:

    • Generate ND3-knockout cell lines for complementation studies

    • Develop inducible expression systems for controlled ND3 levels

    • Create reporter cell lines with mitochondrial function indicators

    • Utilize patient-derived cells with ND3 mutations

  • Methodological controls and standards:

    • Include wild-type ND3 as positive control

    • Use non-functional ND3 mutants as negative controls

    • Incorporate reference standards with established activity

    • Implement internal controls for normalization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.