Recombinant Panax ginseng NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; PSC0521; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSLIPILAFFISGVLAPISKGPEKLSSYESGIEPMGNAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Panax ginseng NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)?

Recombinant Panax ginseng NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a protein encoded by the ndhC gene found in the chloroplast genome of Panax ginseng (Korean ginseng) . This protein functions as a subunit of the NAD(P)H dehydrogenase complex involved in electron transport processes in plant chloroplasts. The protein is categorized under EC 1.6.5.- and is also known as NAD(P)H dehydrogenase subunit 3 or NADH-plastoquinone oxidoreductase subunit 3 . As a chloroplastic protein, ndhC plays an essential role in cyclic electron flow around photosystem I, contributing to ATP synthesis and redox balance within plant cells .

What are the recommended methods for isolation and purification of ndhC?

The isolation and purification of recombinant ndhC protein from Panax ginseng typically follows a multi-step process:

  • Chloroplast isolation using high ionic strength buffer with low pH (3.60)

  • DNA extraction from isolated chloroplasts

  • PCR amplification of the ndhC gene using specific primers

  • Cloning into an expression vector with appropriate purification tags

  • Expression in suitable host systems (typically E. coli)

  • Affinity chromatography purification based on the fusion tag

  • Storage in Tris-based buffer with 50% glycerol

For optimal stability, the purified protein should be stored at -20°C for short-term use or -80°C for extended storage . Researchers should avoid repeated freeze-thaw cycles as they can compromise protein integrity and function. Working aliquots can be maintained at 4°C for up to one week .

How can researchers effectively measure ndhC enzyme activity?

Measuring ndhC enzyme activity requires specialized approaches depending on the experimental context:

Method TypeTechniqueMeasurement ParameterAdvantages
SpectrophotometricNAD(P)H oxidation assayAbsorbance decrease at 340 nmDirect measurement of primary activity
SpectrophotometricQuinone reduction assayChanges in quinone absorption spectraAssesses physiological substrate interaction
PolarographicOxygen consumptionChanges in dissolved oxygenMeasures coupled electron transport
FluorometricROS formationDCF fluorescenceDetects secondary effects of enzyme activity
In vivoPAM fluorometryChlorophyll fluorescence parametersAssesses activity in native environment

For accurate activity calculations, researchers typically use the formula:
Activity (U/mg) = (ΔA₃₄₀ × reaction volume) ÷ (6.22 × protein amount × time)

Where 6.22 is the millimolar extinction coefficient of NAD(P)H at 340 nm. Optimal conditions for ndhC activity measurement include temperature (30-37°C) and pH (7.5-8.0) with appropriate controls for interfering activities .

What evidence exists for ndhC's role in neuroprotection?

Research has established several neuroprotective mechanisms involving pathways related to ndhC function:

The administration of hydrolyzed red ginseng extract (HRGE), which affects pathways involving NAD(P)H:quinone oxidoreductase activity, has demonstrated significant neuroprotective effects in experimental models . In scopolamine-induced cognitive impairment models, HRGE administration at 300 mg/kg body weight successfully reversed learning and memory deficits in behavioral assessments including Y-maze, passive avoidance, and Morris water maze tests . These cognitive improvements correlated with reduced hippocampal damage observed through histological examination .

At the molecular level, HRGE administration increased the expression of nuclear-factor-E2-related factor 2 (Nrf2) and its downstream antioxidant enzymes, including NAD(P)H:quinone oxidoreductase and heme oxygenase-1 in hippocampal tissue . In vitro studies using HT22 mouse hippocampal neuronal cells showed that HRGE treatment attenuated glutamate-induced cytotoxicity by decreasing intracellular reactive oxygen species levels . These findings suggest that ndhC-related pathways may offer neuroprotection through antioxidant mechanisms and prevention of oxidative stress-induced neuronal death.

How does ndhC contribute to cardiovascular protection?

Recent research indicates that ndhC and related components in Panax ginseng contribute to cardiovascular protection through several mechanisms:

  • Energy metabolism remodeling: ndhC-related compounds activate AMP-activated protein kinase (AMPK) and peroxisome proliferator-activated receptor (PPAR) signaling pathways, which are key regulators of cardiac energy metabolism . These pathways have been identified as critical targets through which Panax ginseng produces multiple mechanisms of cardiovascular protection .

  • Protection against ischemic reperfusion injury: Components of Panax ginseng, potentially involving ndhC-related mechanisms, protect cardiomyocytes from damage during ischemia and subsequent reperfusion .

  • Anti-atherosclerotic effects: Research suggests that Panax ginseng and its active ingredients reduce plaque formation and improve endothelial function through mechanisms that may involve ndhC-related pathways .

  • Heart failure mitigation: Studies have demonstrated positive effects on cardiac remodeling and functional recovery in models of heart failure, potentially through improvement of energy metabolism .

A comprehensive review of studies conducted between 2002 and 2023 found that the ingredients in Panax ginseng that demonstrated cardiovascular protective effects are mainly ginsenosides, especially ginsenoside Rb1 . These compounds protect against cardiovascular diseases primarily through improving energy metabolism, inhibiting hyper-autophagy, antioxidant effects, anti-inflammatory actions, and promoting the secretion of protective exosomes .

What controls are essential for experiments investigating ndhC function?

When investigating ndhC function, particularly in antioxidant pathways, several controls are essential:

Control TypeExamplePurpose
Protein controlsDenatured ndhC proteinConfirm effects require functional protein
Purification tag-onlyExclude effects from purification tags
Related oxidoreductasesEstablish specificity of ndhC effects
Pathway controlsNrf2 inhibitors (e.g., ML385)Confirm pathway involvement
Genetic knockdowns/knockoutsVerify pathway dependency
Multiple pathway markersEnsure complete pathway analysis
Oxidative stress controlsKnown antioxidants (N-acetylcysteine)Positive control benchmark
Pro-oxidantsNegative control comparison
Multiple concentrationsEstablish dose-response relationships
Temporal controlsTime-course experimentsDistinguish immediate vs. delayed effects
Pre/co/post-treatment protocolsDetermine preventive vs. therapeutic potential

In scopolamine-induced cognitive impairment studies, proper controls included vehicle-treated groups, positive control groups using established antioxidants, and verification of protein expression changes through western blotting to confirm the involvement of specific antioxidant enzymes .

How can researchers address contradictory findings in ndhC studies?

Addressing contradictions in ndhC research requires systematic approaches:

  • Nanopublication contradiction detection: Implementation of methods to convert study data into nanopublications enables structured, machine-readable formats that facilitate automated detection of contradictions between studies . This approach allows for systematic analysis of claims across multiple research papers.

  • Methodological standardization: Careful analysis of experimental protocols across contradictory studies can identify variations in protein isolation, purification methods, or assay conditions that might explain discrepancies in results .

  • Context-specific effects analysis: Evaluation of whether contradictions arise from differences in experimental context, such as:

    • Plant cultivation conditions affecting ndhC expression

    • Different extraction or processing methods affecting protein structure

    • Variations in experimental models (in vitro vs. in vivo systems)

  • Statistical re-analysis: Meta-analyses of raw data from contradictory studies, using standardized statistical approaches, can determine if contradictions persist when analyzed uniformly .

By systematically analyzing contradictions, researchers can better distinguish between true biological variability and methodological differences, leading to more consistent and reliable findings in ndhC research.

What potential applications does ndhC have in developing new therapeutic approaches?

The potential therapeutic applications of ndhC span several innovative approaches:

  • Neuroprotective agent development:

    • Structure-based design of small molecules that mimic or enhance ndhC antioxidant functions

    • Development of ndhC-derived peptides with enhanced blood-brain barrier penetration

    • Engineering of fusion proteins with targeting moieties for specific neuronal populations

  • Cardiovascular therapeutics:

    • Development of compounds targeting AMPK and PPAR pathways identified as key mechanisms in Panax ginseng's cardiovascular protection

    • Creation of formulations optimized for myocardial energy metabolism remodeling

    • Design of interventions to promote protective exosome secretion

  • Novel delivery systems:

    • Extracellular vesicles and nanoparticles as carriers for optimizing bioavailability of ndhC-related compounds

    • Brain-targeted delivery systems utilizing receptor-mediated transcytosis

    • Sustained-release formulations for chronic neurological conditions

Research with hydrolyzed red ginseng extract has already demonstrated that compounds related to ndhC function can reverse learning and memory deficits, reduce hippocampal damage, and upregulate antioxidant enzymes in mouse models . These findings suggest promising potential for ndhC-based therapeutics in addressing oxidative stress-related pathologies in neurodegenerative and cardiovascular disorders.

How might integrated approaches advance ndhC research?

Advancing ndhC research requires integrated approaches spanning multiple disciplines:

  • Multi-omics integration:

    • Combining proteomics, transcriptomics, and metabolomics to map comprehensive response networks

    • Correlating changes in ndhC expression with global metabolic shifts

    • Developing predictive models of how ndhC perturbations affect cellular systems

  • Translational biology frameworks:

    • Comparative studies between plant and animal NAD(P)H:quinone oxidoreductase systems

    • Development of unified models for oxidoreductase contributions to stress resistance

    • Cross-kingdom investigation of conserved antioxidant mechanisms

  • Bioinformatic tools specialization:

    • Adaptation of tools like BATMAN-TCM for traditional Chinese medicine molecular mechanism analysis

    • Implementation of comparative genomics approaches to study ndhC evolution across plant species

    • Development of specialized databases integrating plant biochemistry and therapeutic applications

By implementing these integrated approaches, researchers can develop a more comprehensive understanding of ndhC's role within complex biological systems and its potential therapeutic applications. This integration would be particularly valuable for understanding how Panax ginseng has evolved specialized metabolic capabilities that contribute to its medicinal properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.