Recombinant Panax ginseng NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplast NDH Complex

The NDH complex operates in cyclic electron flow around photosystem I (PSI) and chlororespiration . ndhG contributes to:

  • Electron Shuttling: Transfers electrons via FMN and Fe-S centers to plastoquinone .

  • Proton Gradient Formation: Couples redox reactions to proton translocation, supporting ATP synthesis .

  • Stress Adaptation: Enhances plant resilience under environmental stress by balancing ATP/NADPH ratios .

Subunit Interactions:

  • ndhG associates with hydrophobic subunits (ndhA–ndhF) in the membrane subcomplex .

  • Stability of ndhG depends on proper folding of ndhH, mediated by chaperonins like Cpn60β4 .

Amino Acid Sequence Alignment

SpeciesKey Sequence Motifs
Nymphaea alba (White water-lily)MDLPAPIHDILLVSLGSGLIVGGLGVVLLTNPIYSAFSLGLVLVCISLFYIPSNSYFVAAAQLLIYVGA...
Mesostigma viride (Algae)MSFSEQIQNLSLLLLEIGTIIGALGVVLLPNILYSGFLLGGVLICIAGIYLLLNAEFIAAAAQVLIYVGA...

Both sequences feature transmembrane helices and conserved residues critical for quinone binding .

Purification and Activity Assays

  • Purity: Recombinant ndhG proteins exhibit >90% purity via SDS-PAGE .

  • Stability: Lyophilized ndhG retains activity at -80°C but degrades with repeated freeze-thaw cycles .

  • Electron Transport Kinetics:

    • In vitro assays show plastoquinone reduction rates of 120–150 µmol·mg⁻¹·h⁻¹ in homologous systems .

Mutational Studies

  • Arabidopsis ndhG Knockouts: Impaired NDH activity, reduced PSI cyclic electron flow, and increased sensitivity to high light .

  • Cyanobacterial Homologs: ndhG deletion disrupts NDH-1L complex assembly, abolishing respiratory electron transport .

Comparative Analysis with Other Subunits

The chloroplast NDH complex comprises 11 plastid-encoded subunits (ndhA–ndhK) and nuclear-encoded auxiliary proteins . Key distinctions:

SubunitRoleInteraction with ndhG
ndhHStabilizes subcomplex ARequired for ndhG integration
ndhDQuinone-binding subunitForms membrane subcomplex with ndhG
ndhLNuclear-encoded stromal subunitNo direct interaction observed

Implications for Panax ginseng Research

While recombinant Panax ginseng ndhG remains understudied, its homologs suggest potential roles in:

  • Metabolic Engineering: Enhancing stress tolerance in medicinal plants .

  • Pharmaceutical Applications: Indirect links to ginsenoside biosynthesis pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate your preference when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; PSC1205; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSHFVAA AQLLIYVGAINVLILFAVMFMNGSEYYKDFHLWTIGDGVTSMVCTSIFVSLITTIPDTSW YGIIWTTKSNQIIEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. It couples the redox reaction with proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.