Recombinant Panax ginseng Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

CP47 is an integral chlorophyll a-binding protein in PSII, acting as an inner antenna that transfers excitation energy to the reaction center. Key functions include:

  • Light Harvesting: Absorbs light at 680 nm and transfers energy to the PSII reaction center .

  • Structural Stabilization: Maintains PSII integrity by anchoring oxygen-evolving enhancer proteins .

  • Electron Transport: Facilitates plastoquinone reduction during water oxidation .

Molecular dynamics simulations reveal that isolated CP47 undergoes structural destabilization, emphasizing the need for recombinant systems to study its native conformation .

3.1. Differential Expression in Wild vs. Cultivated Ginseng

  • Wild ginseng exhibits significantly higher psbB transcript levels compared to cultivated variants (p > 0.05), suggesting environmental or genetic regulation of photosynthetic efficiency .

  • The recombinant protein serves as a biomarker for distinguishing wild ginseng, which is pharmacologically prized for higher bioactive compound production .

3.3. Applications in Immunoassays

  • Recombinant CP47 is used in ELISA kits (e.g., CSB-CF724278EQW) for quantitative analysis, with a detection range optimized for plant physiology research .

Applications in Biotechnology and Medicine

  • Photosynthesis Research: Enables mechanistic studies of energy transfer and PSII assembly .

  • Agricultural Optimization: Guides breeding programs for stress-tolerant crops by linking psbB expression to photosynthetic yield .

  • Phytochemical Production: Wild ginseng’s upregulated psbB correlates with enhanced synthesis of ginsenosides, compounds with antibacterial and anticancer properties .

References

  1. Agrisera Product Sheet: Anti-PsbB antibody specifications and applications .

  2. PubMed Study: Differential psbB expression in wild vs. cultivated ginseng .

  3. MetaCyc Database: CP47’s role in PSII structure .

  4. Quantum Mechanics Analysis: Chlorophyll excitation profiling in CP47 .

  5. ELISA Kit Documentation: Recombinant CP47 production and validation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; PSC0743; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSVTGGAIPNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
Photosystem II CP47 chlorophyll apoprotein (psbB) is a key component of the core complex of photosystem II (PSII). It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical processes of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, generating O2 and a proton gradient that is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene in Panax ginseng and what protein does it encode?

The p-psbB gene in Panax ginseng (also referred to as Panax ginseng chloroplast p-psbB) encodes a chlorophyll a-binding inner antenna protein in the photosystem II complex. This protein is specifically located in the lipid matrix of the thylakoid membrane within the chloroplast . The open reading frame contained in the p-psbB cDNA encodes a protein with 509 amino acids and has a predicted molecular mass of 56,364 Da .

The protein encoded by p-psbB is known as CP47, a critical component of the photosystem II complex that serves as one of the integral antennae of the oxygen-evolving photosystem II. CP47 functions primarily in light harvesting, absorbing light energy and transferring the excitation energy to the reaction center of photosystem II . Additionally, it also plays an important role in accepting excitation energy from the peripheral antenna and transferring it to the reaction center, making it essential for efficient photosynthetic processes.

How does psbB differ between wild and cultivated ginseng?

Expression analysis using RT-PCR and quantitative real-time PCR has revealed significant differences in psbB expression between wild and cultivated ginseng varieties. The p-psbB gene is significantly up-regulated in wild ginseng compared to cultivated ginseng, with transcription levels in cultivated ginseng being nearly undetectable . This differential expression pattern makes p-psbB a potential marker for distinguishing wild ginseng from cultivated varieties.

In RT-PCR analysis, p-psbB transcripts derived from mountain wild ginsengs consistently show an upper band pattern, whereas transcripts from cultivated ginsengs display lower bands . This consistent difference in expression patterns suggests fundamental physiological differences between wild and cultivated ginseng that may relate to their adaptation to different environmental conditions. The molecular mechanisms responsible for this differential expression remain unclear and represent an area requiring further investigation.

What methods are commonly used to isolate and identify psbB genes from Panax ginseng?

The isolation and identification of p-psbB genes from Panax ginseng typically involves several molecular biology techniques. The suppressive subtraction hybridization (SSH) method has been successfully employed to isolate differentially expressed genes in wild ginseng, including the p-psbB gene . This technique involves subtracting wild ginseng cDNAs from a pool of cultivated ginseng cDNAs to enrich for wild-ginseng-specific cDNAs.

The process typically follows these methodological steps:

  • Extraction of total RNA from ginseng samples (both wild and cultivated)

  • cDNA synthesis using reverse transcription

  • Application of suppressive subtraction hybridization to isolate differentially expressed genes

  • PCR amplification of isolated sequences

  • Cloning of amplified fragments into suitable vectors

  • Sequencing of positive clones

  • Sequence analysis for gene identification and characterization

Confirmation of differential expression is typically performed using RT-PCR and real-time quantitative PCR with gene-specific primers designed to amplify cDNA from both cultivated and wild ginsengs . These analytical approaches provide reliable verification of expression differences and can be used to establish the validity of potential genetic markers.

What is the structure of the CP47 protein and how does it function in photosystem II?

The CP47 protein is one of the integral antenna components of the oxygen-evolving photosystem II complex. It contains 16 chlorophyll molecules that play a crucial role in light harvesting and energy transfer . The protein is embedded in the thylakoid membrane and works in coordination with other components of the photosystem II complex to facilitate efficient photosynthesis.

CP47 serves two primary functions in photosynthesis: first, it directly absorbs light energy through its associated chlorophyll molecules; second, it accepts excitation energy from peripheral antenna complexes and transfers this energy to the reaction center of photosystem II . This energy transfer initiates a charge-transfer excitation among coupled reaction center chromophores, which resolves into charge separation and initiates the electron transfer cascade that drives oxygenic photosynthesis .

The exact positioning and orientation of the 16 chlorophyll molecules within CP47 are critical for its function. Research using quantum mechanics/molecular mechanics (QM/MM) approaches has identified specific chlorophylls (B3, followed by B1) as the most red-shifted chlorophylls in CP47, which differs from previous hypotheses in the literature . This arrangement enables efficient directional energy transfer toward the reaction center.

How do environmental stresses affect psbB gene expression in Panax ginseng?

The expression of photosynthesis-related genes, including those encoding chlorophyll a/b-binding proteins in Panax ginseng, can be significantly affected by various environmental stresses. Studies have shown that PgCAB genes, which are related to the light-harvesting complex, respond differently to environmental stressors such as heavy metal exposure, salinity, chilling, and UV stress .

Although specific data on p-psbB expression under different stress conditions is limited, research on related chlorophyll-binding proteins in ginseng suggests that these genes are likely to show stress-specific expression patterns. For instance, the expression of PgCAB genes consistently shows dark-dependent inhibition in leaves, indicating sensitivity to light availability . This light-dependent regulation is likely a general feature of photosynthesis-related genes, including p-psbB.

The differential expression of p-psbB in wild versus cultivated ginseng may also be related to adaptation to different environmental conditions, suggesting that wild ginseng may have developed more efficient photosynthetic mechanisms to survive in its natural habitat . This hypothesis requires further investigation through controlled stress experiments measuring p-psbB expression under various environmental conditions.

What computational approaches are used to study CP47 chlorophyll excitation energies?

Advanced computational approaches have been developed to study the excitation energies of chlorophyll molecules in CP47. One notable methodology is the multiscale quantum mechanics/molecular mechanics (QM/MM) approach that utilizes full time-dependent density functional theory with modern range-separated functionals . This sophisticated approach enables researchers to compute the excitation energies of all CP47 chlorophylls in a complete membrane-embedded cyanobacterial PSII dimer.

The QM/MM approach provides several advantages:

  • It allows quantification of the electrostatic effect of the protein environment on chlorophyll site energies

  • It provides a high-level quantum chemical excitation profile of CP47 within a near-native computational model

  • It enables the ranking of site energies and identification of the most red-shifted chlorophylls

  • It can help resolve discrepancies between different experimental approaches

These computational studies have determined that the B3 chlorophyll, followed by B1, are the most red-shifted chlorophylls in CP47, which differs from previous hypotheses in the literature . This finding provides new insights into the energy transfer pathways within the photosystem II antenna complex.

How can researchers validate the differential expression of psbB between wild and cultivated ginseng?

Validating the differential expression of p-psbB between wild and cultivated ginseng requires a systematic approach using multiple complementary techniques. Based on established methodologies, researchers should consider the following experimental design:

  • Sample collection and RNA extraction: Obtain multiple samples of both wild and cultivated ginseng from different geographical regions. Extract high-quality total RNA using standard protocols.

  • RT-PCR analysis: Design p-psbB gene-specific primers that amplify both wild and cultivated ginseng cDNA. Optimize PCR conditions to ensure that amplification remains within the linear phase. Use a housekeeping gene (e.g., actin) as an internal control .

  • Real-time quantitative PCR: Perform qPCR analysis to quantify the relative expression levels of p-psbB in wild versus cultivated ginseng. Normalize expression data to appropriate reference genes that show stable expression across samples .

  • Statistical analysis: Apply appropriate statistical tests to determine the significance of expression differences. Multiple biological and technical replicates should be included to ensure robust results.

  • Protein-level validation: Confirm that changes in gene expression correspond to changes in protein abundance using techniques such as Western blotting or mass spectrometry.

This comprehensive approach provides multiple lines of evidence for differential expression and helps rule out experimental artifacts or sample-specific effects that might confound the results.

What molecular markers can be used to authenticate wild Panax ginseng based on psbB characteristics?

The differential expression of p-psbB between wild and cultivated ginseng makes it a valuable molecular marker for authentication purposes. Researchers have developed several approaches to leverage this difference for identifying wild ginseng:

  • PCR-based markers: Gene-specific primers can be designed to amplify the p-psbB gene, resulting in different band patterns for wild and cultivated ginseng in gel electrophoresis. RT-PCR analysis has shown that all p-psbB transcripts from wild ginsengs display an upper band pattern, while those from cultivated ginsengs show lower bands .

  • SNP and InDel markers: Research on ginseng plastome diversity has identified 18 polymorphic sites, including 11 SNPs and 7 InDels, from comparative analysis of plastomes from cultivated and wild ginseng accessions . These polymorphisms can be used to develop specific markers for authentication.

  • KASP markers: Kompetitive Allele-Specific PCR (KASP) markers based on SNP variations in the plastome have been developed and applied to diverse genetic resources to identify different haplotypes and their cultivation history . This approach provides a digital haplotyping system that could also be applied to p-psbB variations.

  • qPCR quantification: Given the significantly higher expression of p-psbB in wild ginseng, quantitative PCR can be used to measure expression levels and establish threshold values that distinguish wild from cultivated varieties .

These molecular authentication methods provide more reliable identification than traditional morphological approaches and can be particularly valuable for regulatory purposes and quality control in the ginseng industry.

What are the challenges in expressing recombinant psbB from Panax ginseng in heterologous systems?

Expression of recombinant photosystem proteins, including psbB, presents several technical challenges due to their integral membrane nature and complex folding requirements. Although specific data on recombinant p-psbB expression is limited in the provided search results, similar challenges encountered with other membrane proteins likely apply.

Key challenges include:

  • Membrane protein expression: CP47 is an integral membrane protein located in the thylakoid membrane, making its expression in soluble form difficult in conventional expression systems.

  • Chlorophyll binding: The protein's functionality depends on proper binding of chlorophyll molecules, which may not be readily available in heterologous expression systems.

  • Protein folding: Achieving correct folding of the 509-amino acid protein with its multiple transmembrane domains is challenging in non-native environments.

  • Post-translational modifications: Any required modifications specific to the plant chloroplast environment may be absent in bacterial or yeast expression systems.

Potential solutions to these challenges include:

  • Using specialized expression systems designed for membrane proteins, such as those with strong membrane-protein folding capabilities

  • Co-expression with chlorophyll synthesis pathways or addition of chlorophyll precursors to the expression medium

  • Expressing the protein as fusion constructs with solubility-enhancing tags

  • Expression in chloroplast-containing organisms that can provide the appropriate folding environment

How can researchers design experiments to elucidate the mechanism of psbB upregulation in wild ginseng?

Understanding the mechanism behind p-psbB upregulation in wild ginseng compared to cultivated varieties requires a systematic experimental approach. Although the exact mechanism remains unclear , researchers can design experiments to investigate potential regulatory pathways:

  • Promoter analysis: Clone and sequence the promoter regions of p-psbB from both wild and cultivated ginseng. Analyze these sequences for differences in regulatory elements that might explain expression variations. Use reporter gene assays to test the activity of these promoters in heterologous systems.

  • Epigenetic analysis: Investigate potential epigenetic differences by analyzing DNA methylation patterns and histone modifications in the p-psbB gene region between wild and cultivated ginseng.

  • Transcription factor identification: Use techniques such as yeast one-hybrid assays, DNA affinity purification, or chromatin immunoprecipitation to identify transcription factors that bind to the p-psbB promoter.

  • Environmental response studies: Expose both wild and cultivated ginseng to varying environmental conditions (light intensity, temperature, soil composition) and monitor changes in p-psbB expression to identify environmental triggers that might selectively induce expression in wild ginseng.

  • Comparative transcriptomics: Perform RNA-Seq analysis on wild and cultivated ginseng to identify differentially expressed genes involved in photosynthesis regulation, which might provide insights into upstream regulators of p-psbB.

  • CRISPR-based approaches: Use CRISPR/Cas9 technology to modify potential regulatory regions of p-psbB in cultivated ginseng to determine if expression levels can be elevated to match those of wild ginseng.

These approaches, particularly when used in combination, may help elucidate the regulatory mechanisms responsible for the differential expression of p-psbB in wild versus cultivated ginseng.

What is the relationship between psbB expression and photosynthetic efficiency in Panax ginseng?

The significantly higher expression of p-psbB in wild ginseng compared to cultivated varieties suggests potential differences in photosynthetic efficiency between these types. Wild ginseng, growing under natural forest conditions with potentially limited light availability, may have developed enhanced light-harvesting capabilities through increased CP47 expression. This adaptation could enable more efficient capture and utilization of available light energy in shaded forest environments.

Future research should investigate:

  • Correlation between p-psbB expression levels and measurable photosynthetic parameters (e.g., quantum yield, electron transport rate)

  • Comparative analysis of light response curves between wild and cultivated ginseng

  • Analysis of photosynthetic efficiency under different light intensities and qualities

  • Potential trade-offs between enhanced light harvesting and other physiological processes

Understanding this relationship could provide insights into the ecological adaptation of wild ginseng and potentially inform cultivation practices to optimize photosynthetic efficiency in cultivated varieties.

How might genetic engineering of psbB improve stress tolerance in cultivated Panax ginseng?

Genetic engineering of p-psbB offers potential avenues for improving stress tolerance in cultivated Panax ginseng. Given the relationship between photosynthetic efficiency and stress response, modifying p-psbB expression or structure might enhance resilience to various environmental stressors.

Potential genetic engineering strategies include:

  • Overexpression of native p-psbB: Engineering cultivated ginseng to express p-psbB at levels comparable to wild ginseng might enhance light-harvesting efficiency and energy transfer, potentially improving performance under suboptimal light conditions.

  • Introduction of stress-responsive regulatory elements: Modifying the promoter of p-psbB to include stress-responsive elements could enable dynamic regulation of CP47 production in response to specific environmental challenges.

  • Structure-guided protein engineering: Based on the detailed understanding of CP47 structure and chlorophyll binding sites , specific amino acid modifications could be introduced to enhance protein stability under stress conditions or optimize energy transfer efficiency.

  • Multigene engineering approaches: Coordinated modification of p-psbB along with other photosynthesis-related genes might yield synergistic improvements in stress tolerance.

Future research should evaluate these genetic engineering strategies through controlled stress experiments, measuring both p-psbB expression and physiological stress responses. This work could significantly contribute to developing more resilient ginseng varieties for cultivation under diverse and challenging environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.