Recombinant Panax ginseng Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
psbD; PSC00348; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Names
psbD
Target Protein Sequence
MTIALGKFTEDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENLYFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor, and several subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for producing Recombinant Panax ginseng psbD protein?

The most documented expression system for Recombinant Panax ginseng Photosystem II D2 protein is Escherichia coli. This prokaryotic expression system offers several methodological advantages for photosystem protein production:

  • Relatively high yield compared to plant-based extraction methods

  • Reduced complexity in purification protocols

  • Ability to introduce affinity tags (such as His-tag) for simplified purification

  • Cost-effectiveness for laboratory-scale production

The expression methodology typically involves cloning the psbD gene into an appropriate expression vector with an N-terminal His-tag sequence. Following transformation into E. coli, protein expression is induced under controlled conditions optimized for membrane protein production (often lower temperatures of 18-25°C and reduced inducer concentrations) .

Alternative expression systems including yeast (Pichia pastoris) and insect cells may potentially offer advantages for proper folding of this complex membrane protein, though these are not documented in the provided search results for this specific protein.

How should researchers store and reconstitute lyophilized Recombinant Panax ginseng psbD protein?

For optimal stability and functionality of Recombinant Panax ginseng Photosystem II D2 protein, researchers should follow these evidence-based storage and reconstitution protocols:

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage requires -20°C/-80°C with 50% glycerol as a cryoprotectant

Reconstitution methodology:

  • Briefly centrifuge the vial before opening to collect all material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%) for long-term storage

  • Prepare small working aliquots to minimize freeze-thaw cycles

The reconstituted protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability and functionality for experimental applications .

What are the best methodological approaches for studying functional characteristics of Recombinant Panax ginseng psbD in photosynthetic electron transport?

To investigate the functional role of Recombinant Panax ginseng Photosystem II D2 protein in photosynthetic electron transport, researchers should consider the following methodological approaches:

Electron transport measurements:

  • Oxygen evolution assays using artificial electron acceptors (e.g., ferricyanide, DCBQ)

  • Chlorophyll fluorescence measurements to assess photosystem II efficiency

  • P680+ reduction kinetics to evaluate primary electron donation

  • QA- reoxidation studies to assess forward electron transfer

Protein-protein interaction analysis:

  • Co-immunoprecipitation with other photosystem II components

  • Crosslinking studies to identify interaction partners

  • Surface plasmon resonance (SPR) for binding kinetics

  • Blue native PAGE to study complex formation

For these methodologies, it's critical to maintain the protein in a suitable membrane environment or reconstitute it into liposomes to preserve its native conformation and function. The His-tag present in the recombinant protein can be leveraged for oriented reconstitution or immobilization in various experimental setups .

How can researchers assess the structural integrity of purified Recombinant Panax ginseng psbD protein?

Assessing structural integrity is crucial for ensuring experimental validity when working with Recombinant Panax ginseng Photosystem II D2 protein. Researchers should employ multiple complementary techniques:

Primary structure confirmation:

  • Mass spectrometry (MS) to verify the accurate molecular weight

  • Peptide mapping after controlled proteolysis

  • N-terminal sequencing to confirm expression fidelity

Secondary structure analysis:

  • Circular dichroism (CD) spectroscopy to quantify α-helix and β-sheet content

  • FTIR spectroscopy to analyze secondary structure elements

  • Comparative analysis with theoretical predictions based on the amino acid sequence

Tertiary structure assessment:

  • Intrinsic fluorescence spectroscopy to probe tryptophan environments

  • Limited proteolysis patterns to examine domain folding

  • Thermal shift assays to determine protein stability

Table 1: Techniques for Structural Assessment of Recombinant psbD Protein

Assessment LevelTechniqueInformation ObtainedSample Requirements
Primary StructureMass SpectrometryExact molecular weight10-100 μg protein
Peptide MappingSequence coverage10-50 μg protein
Secondary StructureCD Spectroscopyα-helix/β-sheet content0.1-0.5 mg/ml, 200 μl
FTIRSecondary structure elements1-2 mg/ml, 50 μl
Tertiary StructureFluorescenceTryptophan environments0.1 mg/ml, 500 μl
Limited ProteolysisDomain organization0.2-1 mg/ml, 100 μl

When evaluating purity, SDS-PAGE should show a single band with >90% purity, consistent with the expected molecular weight of the full-length protein (approximately 40 kDa including the His-tag) .

What are the critical considerations for experimental design when comparing wild-type versus mutant forms of Panax ginseng psbD protein?

When designing experiments to compare wild-type and mutant forms of Panax ginseng Photosystem II D2 protein, researchers must address several methodological challenges:

Expression system consistency:

  • Use identical expression vectors with the same promoters and regulatory elements

  • Maintain consistent culture conditions, induction parameters, and cell density

  • Process both proteins simultaneously through identical purification protocols

  • Quantify expression levels and normalize for comparative analyses

Structural equivalence verification:

  • Confirm proper folding of both proteins using the techniques discussed in section 2.2

  • Assess thermal stability profiles using differential scanning calorimetry

  • Evaluate cofactor binding properties where applicable

  • Document any differences in oligomerization states

Functional analysis controls:

  • Design paired experiments with internal controls

  • Include concentration-response relationships for both proteins

  • Account for potential differences in specific activity when comparing results

  • Establish statistical significance using appropriate sample sizes and replicates

When analyzing electron transport capabilities, researchers should systematically examine different segments of the electron transport chain to identify specific points where mutations affect function. This stepwise approach helps isolate effects to specific electron transfer steps rather than general protein instability .

How can recombinant psbD protein be used to study herbicide resistance mechanisms in photosystem II?

Recombinant Panax ginseng Photosystem II D2 protein provides an excellent experimental system for investigating herbicide resistance mechanisms. Many herbicides (e.g., triazines, ureas) target the QB binding site, which involves the D2 protein. The following methodological framework is recommended:

Binding studies approach:

  • Isothermal titration calorimetry (ITC) to determine binding constants for different herbicides

  • Fluorescence quenching assays to measure herbicide binding in competitive assays

  • Surface plasmon resonance for real-time binding kinetics

  • Computational docking simulations guided by experimental data

Site-directed mutagenesis protocol:

  • Identify conserved residues in the herbicide binding pocket

  • Create a library of point mutations using PCR-based mutagenesis

  • Express and purify mutant proteins using identical protocols

  • Screen mutants for altered herbicide binding profiles

Functional resistance assessment:

  • Electron transport measurements in the presence of increasing herbicide concentrations

  • Determination of IC50 values for wild-type versus mutant proteins

  • Oxygen evolution assays to quantify functional inhibition

  • Thermodynamic analysis of binding energy differences

This systematic approach allows researchers to establish structure-function relationships for herbicide binding and resistance, potentially informing the development of new herbicides or herbicide-resistant crops .

How does Panax ginseng psbD structurally and functionally compare to psbD proteins from other photosynthetic organisms?

Researchers investigating comparative aspects of photosystem II D2 proteins should consider the following methodological framework:

Sequence alignment analysis:
Panax ginseng psbD shows high conservation with other plant psbD sequences, reflecting the fundamental importance of this protein in photosynthesis. Key functional domains, particularly those involved in cofactor binding and electron transfer, display the highest conservation. The membrane-spanning regions and quinone binding sites typically show >90% identity across plant species, while some loop regions may exhibit greater variability.

Structural comparison approach:

  • Generate homology models based on available high-resolution crystal structures

  • Superimpose models to identify conserved versus variable regions

  • Analyze cofactor binding sites for species-specific differences

  • Examine potential differences in protein-protein interaction surfaces

Functional conservation assessment:

  • Compare electron transfer rates under standardized conditions

  • Assess sensitivity to environmental factors (temperature, pH, light intensity)

  • Evaluate herbicide binding profiles across species

  • Examine species-specific post-translational modifications

This comparative approach provides insights into evolutionary constraints on psbD function and can highlight species-specific adaptations that may correlate with environmental niches or photosynthetic strategies .

What techniques can be used to study the interaction between recombinant psbD and other photosystem II components?

Understanding protein-protein interactions is essential for elucidating photosystem II assembly and function. The following methodological approaches are recommended for studying interactions between recombinant Panax ginseng psbD and other photosystem components:

In vitro reconstitution methods:

  • Sequential addition of purified components in detergent micelles or liposomes

  • Monitoring complex assembly via size-exclusion chromatography

  • Electron microscopy to visualize complexes

  • Functional assessment of reconstituted complexes

Affinity-based interaction studies:

  • Pull-down assays using the His-tag on recombinant psbD

  • Surface plasmon resonance for binding kinetics determination

  • Isothermal titration calorimetry for thermodynamic parameters

  • FRET-based assays for proximity analysis

Crosslinking methodology:

  • Chemical crosslinking with homobifunctional or heterobifunctional reagents

  • Photo-crosslinking at specific sites using modified amino acids

  • Mass spectrometric analysis of crosslinked products

  • Computational modeling based on crosslinking constraints

Table 2: Comparison of Protein Interaction Detection Methods

TechniqueAdvantagesLimitationsSensitivity
Pull-down assaysDirect physical interactionMay lose weak interactionsMedium
SPRReal-time kineticsRequires surface immobilizationHigh
CrosslinkingWorks in native environmentComplex data interpretationMedium-High
ITCProvides thermodynamic dataRequires large sample amountsMedium
FRETWorks in living systemsDistance constraints (1-10 nm)High

These complementary approaches provide a comprehensive picture of how psbD interacts with other components to form functional photosystem II complexes .

What are common challenges in expressing and purifying functional Recombinant Panax ginseng psbD, and how can they be overcome?

Researchers working with Recombinant Panax ginseng Photosystem II D2 protein frequently encounter technical challenges. Here are methodological solutions to common problems:

Expression challenges:

  • Problem: Low expression levels
    Solution: Optimize codon usage for E. coli, reduce culture temperature (18-25°C), test different E. coli strains (BL21(DE3), C41/C43)

  • Problem: Inclusion body formation
    Solution: Express at lower temperatures, reduce inducer concentration, use solubility-enhancing fusion tags, add mild detergents during cell lysis

  • Problem: Protein instability
    Solution: Add protease inhibitors throughout purification, work at 4°C, minimize time between steps

Purification challenges:

  • Problem: Poor His-tag binding
    Solution: Ensure tag is not obscured by protein folding, use denaturing conditions temporarily, optimize imidazole concentration in binding buffer

  • Problem: Contaminant proteins
    Solution: Implement a two-step purification (IMAC followed by gel filtration), optimize wash conditions, use gradient elution

  • Problem: Precipitation during concentration
    Solution: Add glycerol (5-10%), include stabilizing agents (trehalose, sucrose), concentrate more slowly at lower pressure

Functional assessment challenges:

  • Problem: Loss of activity after purification
    Solution: Verify proper reconstitution in appropriate membrane mimetics (liposomes, nanodiscs), ensure all cofactors are present, optimize buffer conditions

  • Problem: High background in activity assays
    Solution: Include additional purification steps, optimize protein:lipid ratios, include appropriate controls

Implementing these methodological solutions can significantly improve the quality and functionality of recombinant psbD preparations .

How can researchers distinguish between native and non-native conformations of recombinant psbD protein?

Distinguishing between native and non-native conformations is crucial for ensuring experimental validity. Researchers should implement the following methodological approaches:

Spectroscopic techniques:

  • Circular dichroism to compare secondary structure profiles with predicted models

  • Intrinsic fluorescence to assess tertiary structure and tryptophan environments

  • FTIR spectroscopy to evaluate secondary structure in membrane environments

  • NMR spectroscopy for more detailed structural characterization where feasible

Functional markers:

  • Cofactor binding capacity compared to native protein

  • Electron transfer efficiency in reconstituted systems

  • Herbicide binding profiles as a probe for correct QB pocket formation

  • Interaction capacity with known partner proteins

Stability indicators:

  • Thermal denaturation profiles (DSC or CD-monitored)

  • Resistance to limited proteolysis compared to denatured controls

  • Detergent resistance as a measure of proper membrane protein folding

  • Long-term activity retention under storage conditions

Table 3: Distinguishing Native vs. Non-native psbD Conformations

ParameterNative ConformationNon-native Conformation
α-helix content~60-65%Reduced (<50%)
Thermal stabilityTm > 50°C (in membrane)Tm < 40°C
Cofactor bindingStoichiometricReduced or absent
Proteolysis patternLimited discrete fragmentsExtensive degradation
Electron transferActiveReduced or inactive

These complementary approaches provide a robust assessment of whether the recombinant protein has achieved its native conformation, which is essential for valid functional studies .

How can Recombinant Panax ginseng psbD be utilized in artificial photosynthesis research?

Recombinant Panax ginseng Photosystem II D2 protein offers significant potential for artificial photosynthesis applications. Researchers should consider the following methodological approaches:

Biohybrid system development:

  • Immobilization of recombinant psbD in conjunction with other PSII components on electrodes

  • Integration with synthetic light-harvesting materials

  • Coupling with artificial catalysts for water oxidation

  • Creation of liposome/nanodisc systems with oriented protein incorporation

Electron transfer optimization:

  • Systematic mutation of residues involved in electron transfer pathways

  • Introduction of non-natural amino acids to modulate redox potentials

  • Cofactor substitution to alter electron transfer rates

  • Engineering connections to non-biological electron acceptors

Stability enhancement strategies:

  • Identification and modification of oxidation-sensitive residues

  • Incorporation of stabilizing mutations from extremophile organisms

  • Computational design of stabilizing interactions within the protein structure

  • Encapsulation techniques to protect from reactive oxygen species damage

These approaches can contribute to the development of more efficient and stable artificial photosynthetic systems for solar energy conversion and storage .

What methodological approaches can be used to study the impact of environmental stressors on psbD structure and function?

Environmental stressors significantly impact photosynthetic efficiency in plants. Researchers investigating these effects on Recombinant Panax ginseng psbD should implement the following methodological framework:

Temperature stress analysis:

  • Thermal stability assays comparing wild-type and stress-adapted variants

  • Activity measurements across temperature gradients (5-45°C)

  • Structural analysis at different temperatures using CD spectroscopy

  • Kinetic measurements of electron transfer at diverse temperatures

Oxidative stress methodology:

  • Controlled exposure to defined concentrations of reactive oxygen species

  • Identification of oxidation-sensitive residues via mass spectrometry

  • Site-directed mutagenesis of vulnerable residues to more resistant amino acids

  • Functional assessment before and after oxidative challenge

Light stress experimental design:

  • Exposure to different light intensities and spectral compositions

  • Analysis of photodamage patterns and repair mechanisms

  • Comparison with in vivo responses in intact Panax ginseng

  • Integration with protective mechanisms (carotenoids, NPQ)

Table 4: Environmental Stress Effects on psbD Parameters

Environmental StressPrimary EffectSecondary EffectsAssessment Methods
High TemperatureProtein unfoldingLoss of cofactors, aggregationCD, activity assays, thermal shift
Oxidative StressAmino acid oxidationStructural destabilizationMass spec, activity loss rate
Excess LightD1/D2 damageReduced electron flowOxygen evolution, fluorescence
UV RadiationProtein crosslinkingConformational changesSDS-PAGE, fluorescence

This systematic approach allows researchers to elucidate the molecular basis of stress sensitivity and resistance in photosystem II D2 protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.