Recombinant Panax ginseng Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

2.1. Photosynthetic Efficiency and Stress Response

  • Light Intensity Adaptation: Under 100 µmol m⁻²·s⁻¹ light intensity, psbA expression in P. ginseng leaves is upregulated, enhancing PSII reaction center activity and photosynthetic carbon fixation . This correlates with a 68.32% increase in total ginsenosides compared to low-light conditions .

  • Salt Stress: PsbA abundance decreases under salinity stress, leading to inhibited photosynthesis and carbon fixation. Concurrently, related proteins (e.g., RuBisCO activase) are downregulated, exacerbating metabolic disruption .

2.2. Wild vs. Cultivated Ginseng Differentiation

  • While wild ginseng studies primarily focus on the p-psbB gene (a PSII antenna protein), psbA’s structural conservation across plants suggests its utility as a marker for photosynthetic efficiency in P. ginseng cultivars .

3.1. Phytochemical Production

  • Enhanced psbA expression under optimal light conditions boosts ginsenoside synthesis, with key metabolites (Rg1, Rb1, Rd) increasing by 1.28–2.59-fold .

  • Mechanistic Insight: PsbA stabilizes PSII, indirectly supporting terpenoid backbone biosynthesis via upregulated HMGR and CYP450 enzymes .

3.2. Molecular Tools

  • Recombinant psbA serves as a quantitation standard for D1 protein studies (e.g., immunoblotting) .

  • Used in comparative analyses of PSII integrity in genetically modified P. ginseng lines .

Challenges and Future Directions

  • Expression Variability: Recombinant psbA production in E. coli may lack post-translational modifications critical for native function .

  • Functional Studies: Further research is needed to link psbA isoforms (e.g., psbA2/psbA3) to stress resilience in P. ginseng .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; PSC0004; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAAAAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H2O, producing O2 and a proton gradient that subsequently drives ATP formation. PSII comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts light excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant psbA protein?

For maintaining the integrity and activity of recombinant Panax ginseng psbA protein, researchers should implement the following protocol:

  • Store the protein at -20°C for routine use and at -80°C for extended storage periods

  • Use storage buffer containing Tris-based components with 50% glycerol, optimized for protein stability

  • Avoid repeated freezing-thawing cycles as they significantly compromise protein structure

  • Maintain working aliquots at 4°C for no longer than one week

  • Implement regular quality control through activity assays or structural analysis

This membrane protein is particularly susceptible to denaturation, requiring careful handling to preserve its functional properties for experimental applications.

How does psbA differ between Panax ginseng and other plant species?

While the psbA gene is highly conserved across photosynthetic organisms due to its essential role, Panax ginseng's psbA exhibits species-specific adaptations that reflect its evolutionary history and ecological niche. Comparative genomic approaches reveal:

  • The core functional domains, particularly those involved in electron transport and quinone binding, show high conservation across species

  • Variations primarily occur in regions exposed to the stromal side of the thylakoid membrane

  • Panax ginseng's psbA contains adaptations that may correlate with its understory growth habit in forest environments, potentially optimizing its function under variable light conditions

These differences have important implications for understanding photosynthetic adaptation and may provide insights into the specialized photosynthetic characteristics of medicinal plants like ginseng.

What expression systems are most effective for producing functional recombinant psbA protein?

When selecting an expression system for recombinant Panax ginseng psbA, researchers should consider these methodological approaches:

  • Chloroplast transformation systems provide the most native-like environment for psbA expression, utilizing chloroplast-specific vectors with the 16S rRNA promoter and psbA 5' and 3' untranslated regions to enhance translation in light .

  • Heterologous expression comparison:

Expression SystemAdvantagesLimitationsYield Potential
E. coliRapid growth, established protocolsLacks post-translational machinery, inclusion body formationModerate
Yeast systemsEukaryotic processing, scalablePotential glycosylation differencesModerate
Plant-based systemsNative folding environmentSlower growth, complex extractionHigh
Chloroplast-specificNatural processing, high expressionComplex transformationVery high
  • For optimal expression, vector design should incorporate:

    • psbA 5' and 3' untranslated regions to enhance translation in light conditions

    • Appropriate selectable markers (e.g., spectinomycin resistance)

    • Homologous flanking sequences for site-specific integration into the chloroplast genome

What purification protocols yield the highest recovery of functional psbA protein?

Purification of functional psbA protein requires specialized techniques due to its membrane-embedded nature:

  • Initial extraction:

    • Use young, photosynthetically active tissues

    • Implement rapid extraction under minimal light conditions

    • Incorporate protease inhibitors to prevent degradation

  • Membrane isolation and solubilization:

    • Differential centrifugation to isolate thylakoid membranes

    • Mild detergent solubilization (β-DM, α-DM, or digitonin at carefully optimized ratios)

    • Temperature control throughout the procedure (4°C)

  • Chromatographic separation:

    • Ion exchange chromatography (typically anion exchange)

    • Size exclusion chromatography for final purification

    • For recombinant tagged proteins, affinity chromatography

  • Quality assessment:

    • Spectroscopic analysis (absorption spectrum 350-750 nm)

    • Western blotting with anti-D1 antibodies

    • Activity assays measuring electron transport capability

This integrated approach maximizes both yield and functionality of the isolated protein.

What methods are most reliable for assessing psbA photosynthetic activity?

Functional analysis of psbA requires multiple complementary approaches:

  • Oxygen evolution measurements:

    • Clark-type oxygen electrodes quantify photosynthetic water-splitting

    • Artificial electron acceptors (p-benzoquinone or ferricyanide) are incorporated

    • Results are typically expressed as μmol O₂/mg chlorophyll/hour

  • Electron transport assessment:

    • Chlorophyll fluorescence techniques (e.g., PAM fluorometry) measure PSII quantum yield

    • JIP-test methodology evaluates specific steps in electron transport

    • P700 absorbance changes provide insights into PSI-PSII electron flow

  • Protein-specific binding studies:

    • Radioligand binding assays with labeled QB analogs

    • EPR spectroscopy for radical formation measurement

    • Thermoluminescence to quantify charge recombination events

  • Reconstitution experiments:

    • Integration of purified protein into liposomes

    • Measurement of electron transfer in the reconstituted system

    • Comparison with native membrane preparations

These methodologies together provide a comprehensive assessment of psbA functionality.

How can researchers distinguish between native and recombinant psbA proteins in experimental systems?

Differentiating between native and recombinant psbA presents several challenges that can be addressed through:

  • Epitope tagging strategies:

    • C-terminal tags minimally interfere with function

    • Small epitopes (His, FLAG) with flexible linkers preserve protein activity

    • Internal tagging requires detailed structural knowledge

  • Immunological approaches:

    • Development of antibodies against unique regions or tags

    • Western blot optimization with appropriate membrane protein extraction methods

    • Two-dimensional electrophoresis for isoform separation

  • Mass spectrometry techniques:

    • Identification of unique peptides following digestion

    • Quantitative proteomics using labeled reference peptides

    • Top-down proteomics for intact protein analysis

  • Functional discrimination:

    • Introduction of specific mutations that alter function in measurable ways

    • Use of selective inhibitors with differential effects

    • Spectroscopic methods that detect structural differences

These approaches enable researchers to monitor recombinant protein in the presence of native proteins.

How does psbA contribute to the stress response mechanisms in Panax ginseng?

The psbA protein plays a central role in plant stress responses, particularly those involving light and oxidative damage:

  • Photoinhibition and repair cycle:

    • psbA/D1 is the primary damaged component during high light stress

    • Rapid turnover of D1 is essential for maintaining photosynthetic capacity

    • The repair cycle involves proteolytic removal of damaged D1 and replacement with newly synthesized protein

  • Oxidative stress management:

    • D1 contains specific amino acids that act as sacrificial targets for reactive oxygen species

    • This "programmed damage" protects other components of the photosynthetic apparatus

    • The rate of D1 synthesis and degradation serves as a sensor for cellular stress levels

  • Connection to secondary metabolism:

    • Photosynthetic stress in Panax ginseng appears to influence production of medicinal compounds

    • Moderate photosystem stress may trigger hormetic responses that enhance ginsenoside production

    • This connection suggests photosynthetic efficiency plays an underappreciated role in medicinal properties

Understanding these mechanisms has implications for both basic research and applied cultivation strategies for medicinal ginseng.

What novel applications of CRISPR-Cas9 technology can advance psbA research in Panax ginseng?

CRISPR-Cas9 technology offers transformative approaches for psbA research:

  • Chloroplast genome editing strategies:

ApproachTargetPotential Insights
Point mutationsSpecific functional residuesStructure-function relationships
Domain swappingQB-binding regionSpecies-specific adaptations
Promoter modificationsExpression regulationStress response mechanisms
  • Methodological considerations:

    • Chloroplast-specific delivery systems (biolistics preferred)

    • Selection strategies for achieving homoplasmy

    • Off-target effect minimization through careful guide RNA design

  • Research applications:

    • Creation of photosynthetically enhanced ginseng lines

    • Introduction of reporter systems for real-time monitoring of photosynthetic activity

    • Development of herbicide-resistant variants as selection markers

    • Investigation of psbA evolution through recreation of ancestral sequences

  • Technical challenges:

    • Low efficiency of chloroplast transformation

    • Need for multiple selection rounds to achieve homoplasmy

    • Phenotypic analysis complexity due to photosynthetic network effects

These approaches can provide unprecedented insights into psbA function in Panax ginseng.

How do post-translational modifications affect psbA protein function in Panax ginseng?

Post-translational modifications significantly impact psbA activity through multiple mechanisms:

  • Phosphorylation:

    • N-terminal threonine phosphorylation occurs during state transitions

    • Detection methods include Phos-tag gels, phospho-specific antibodies, and mass spectrometry

    • Functional impact includes altered PSII-LHCII association and protein degradation regulation

  • Oxidative modifications:

    • Methionine, cysteine, and tryptophan residues near functional centers are primary targets

    • These modifications serve as signals for D1 degradation during photoinhibition

    • Identification requires specialized redox proteomics approaches

  • Proteolytic processing:

    • C-terminal processing by CtpA protease is essential for manganese cluster assembly

    • This processing is required for oxygen-evolving capability

    • Detection methods include size-specific antibodies and mass spectrometry

  • Research implications:

    • Post-translational modification patterns may differ between native and recombinant proteins

    • Environmental conditions significantly influence modification patterns

    • Modifications provide potential targets for enhancing photosynthetic efficiency

Understanding these modifications is critical for accurate interpretation of experimental results with recombinant proteins.

How can structural biology inform functional studies of psbA protein?

Integration of structural and functional approaches provides synergistic insights:

  • Structure-function correlation methods:

    • High-resolution structures from X-ray crystallography or cryo-EM

    • Site-directed mutagenesis of key residues identified in structures

    • Functional measurements of electron transport with mutant proteins

  • Dynamic structural techniques:

    • Hydrogen-deuterium exchange mass spectrometry identifies flexible regions

    • EPR spectroscopy with site-specific spin labels measures local environment changes

    • Molecular dynamics simulations predict conformational changes during function

  • Time-resolved approaches:

    • Serial crystallography captures different functional states

    • Time-resolved spectroscopy correlates structural changes with electron transfer events

    • Integration of data through computational modeling

  • Application to Panax ginseng research:

    • Identification of ginseng-specific structural features

    • Correlation with photosynthetic performance under shade conditions

    • Potential optimization of photosynthetic efficiency in cultivated ginseng

These integrated approaches provide a comprehensive understanding of structure-function relationships.

What role might psbA play in the medicinal properties of Panax ginseng?

Although primarily known for its photosynthetic function, psbA may have unexpected connections to medicinal properties:

  • Photosynthesis and secondary metabolite production:

    • Photosynthetic efficiency directly impacts carbon availability for secondary metabolism

    • The stress signaling network connected to photosystem II may influence ginsenoside biosynthesis

    • Correlation between light conditions, photosynthetic performance, and medicinal compound accumulation

  • Reactive oxygen species and signaling:

    • psbA/D1 turnover generates controlled levels of reactive oxygen species

    • These ROS function as signaling molecules that can trigger secondary metabolite production

    • Photosynthetic electron transport chain serves as a cellular redox sensor

  • Research implications:

    • Manipulating psbA expression or activity may offer novel approaches to enhance medicinal compound production

    • Light treatment protocols based on photosystem responses could optimize cultivation

    • Selection of ginseng varieties with specific psbA variants might improve medicinal properties

This emerging research area suggests photosynthetic properties may be more directly linked to medicinal value than previously recognized .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.