Recombinant Panax ginseng Squalene monooxygenase SE1 (SQE1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
SQE1; GSE; SE; SQE; Squalene monooxygenase SE1; Squalene epoxidase 1; PgSQE1; SE1; gse
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Protein Sequence
MNSSSSTTTTDTLHSFMEASALLIDQYFLGWIFAFLFGFLLLLNFKRKREKNNSTEFGTD
DSNGYYTPENIAGSTDVIIVGAGVAGSALAYTLANDGRRVHVIERDLTEQDRIVGELLQP
GGYLKLIELGLEDCVNEIDAQRVFGYALYMDGKNTRLSYPLEKFHSDVAGRSFHNGRFVQ
RMREKAASLPNVRMEQGTVTSLVEKKGSVKGVQYKTKDGQELSAFAPLTIVCDGCFSNLR
RSLCNPKVEVPSCFVGLILENIDLPHINHGHVILADPSPILFYKISSTEIRCLVDVPGQK
VPCISNGELANYLKTVVAPQVPKQLYNSFIAAVDKGNIRTMPNRSMPADPHPTPGALLLG
DAFNMRHPLTGGGMTVALSDIVLIRDLLRPLRDLHDSSTLCKYLESFYTLRKPVASTINT
LAGALYKVFCASPDKARQEMRNACFDYLSLGGICSQGPIALLSGLNPRPISLFLHFFAVA
IYGVGRLLIPFPSPKRMWLGARLILGASGIIFPIIKSEGLRQMFFPAIVPAYYRAPPIH
Uniprot No.
Target Background
Function
A component of triterpene saponin (e.g., ginsenosides or panaxosides) and phytosterol biosynthetic pathways. This enzyme catalyzes the initial oxygenation step in sterol biosynthesis and is considered a rate-limiting enzyme in this pathway.
Protein Families
Squalene monooxygenase family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Mostly expressed in flower buds and leaves, and, to a lower extent, at high levels thought, in roots and petioles. In petioles, preferentially observed in vascular bundle tissue (phloem cells and parenchymatous cells near xylem) and resin ducts.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
