Recombinant Panicum streak virus Movement protein (V2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Panicum Streak Virus Movement Protein (V2)

The Recombinant Panicum Streak Virus Movement Protein (V2) is a full-length, engineered protein derived from the Panicum streak virus (PanSV), a member of the Geminiviridae family. This protein, encoded by the V2 gene (UniProt ID: Q00336), facilitates viral cell-to-cell movement in host plants and is critical for systemic infection . The recombinant form is expressed in Escherichia coli with an N-terminal His tag for purification and functional studies .

Functional Role in Viral Pathogenesis

The V2 protein is essential for cell-to-cell movement of PanSV, enabling systemic spread in host plants like millet and maize . In geminiviruses, movement proteins (MPs) like V2 interact with host plasmodesmata to facilitate viral genome transport between cells . Structural studies suggest the His-tagged recombinant V2 retains functional activity, as evidenced by its solubility and compatibility with downstream applications .

Key Functional Insights:

  • Mechanism: Acts as a nuclear shuttle protein, coordinating with viral replication-associated proteins (e.g., Rep) for systemic infection .

  • Host Interaction: May modulate plasmodesmata or interact with host factors to overcome cell barriers .

  • Genetic Context: The V2 gene is located on the virion-sense strand of the PanSV genome, alongside the coat protein (CP) gene .

Table 2: Production and Purification Workflow

StepDetails
Expression HostE. coli (induced with IPTG)
Purification MethodNi-NTA affinity chromatography (His tag)
Purity AssessmentSDS-PAGE (>90% purity)
ReconstitutionDeionized water (0.1–1.0 mg/mL); glycerol (50%) for long-term storage
Storage-20°C/-80°C (avoid freeze-thaw cycles)

The recombinant V2 protein is typically produced in large-scale E. coli cultures, followed by chromatographic purification . Its full-length structure (1–108 aa) ensures retention of functional motifs critical for movement .

Table 3: Primary Applications of Recombinant V2 Protein

ApplicationPurpose
SDS-PAGEPurity validation and structural analysis
ELISA DevelopmentDetection of anti-V2 antibodies in host plants or experimental models
Functional StudiesInvestigating plasmodesmata interaction and viral movement mechanisms
Protein-Protein InteractionsMapping interactions with host factors or viral proteins (e.g., CP)

The His-tagged V2 protein is particularly valuable for antibody production and epitope mapping, as demonstrated in ELISA assays . Its recombinant form enables controlled studies of viral movement dynamics without relying on infectious viral particles .

V2 in PanSV vs. Related Viruses

PanSV’s V2 shares structural and functional similarities with movement proteins from other geminiviruses (e.g., maize streak virus [MSV]) . Comparative studies reveal:

  • Conserved Motifs: Amino acid residues critical for plasmodesmata interaction are conserved across Mastrevirus MPs .

  • Mobility Differences: MSV-A strains exhibit greater geographical mobility than PanSV, potentially linked to differences in V2 efficiency or host adaptation .

Recombination and Host Specificity

Recombination events at the V2-CP interface may influence host range and virulence . For example:

  • Recombination Hotspots: Observed at the cp/SIR (short intergenic region) interface in geminiviruses, which could affect V2 function .

  • Evolutionary Trade-offs: Enhanced mobility in MSV-A may correlate with V2 adaptations, though direct evidence in PanSV remains limited .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
V2; Movement protein; MP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Panicum streak virus (isolate Kenya) (PanSV)
Target Names
V2
Target Protein Sequence
MDASSQYSALPYPQPPRVPSAAPSAGRLPWSRVGEIVIFTFVSVLALYLLWLWVLKDCIL LLKAQRGRSTEELIFGPGERPPVASADGSRPVPDPSPPVRRDLDLSRV
Uniprot No.

Target Background

Function
This protein is involved in the transport of viruses within and between cells.
Protein Families
Mastrevirus movement protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What characterizes movement proteins in Panicum viruses?

Movement proteins in Panicum viruses, such as the p8 and p6.6 proteins of PMV, are typically small proteins that facilitate cell-to-cell spread of viral infection. These proteins often localize to cell wall fractions, which is characteristic of movement proteins that modify plasmodesmata to allow viral passage between cells. In PMV, abolishing expression of p8 and p6.6 does not affect viral replication in protoplasts but prevents spread in intact plants, confirming their role in intercellular movement . Movement proteins commonly have specific subcellular localization patterns that correspond to their function, with many accumulating in cell wall- and membrane-enriched fractions where they can access and modify plasmodesmata .

How do movement proteins facilitate viral spread through plant tissues?

Movement proteins enable viral spread through complex interactions with host cellular components. In PMV, the 8-kDa protein preferentially localizes to cell wall fractions, similar to known movement proteins of other viruses in the Tombusviridae family . This localization allows these proteins to modify plasmodesmata, the intercellular channels that connect plant cells. Some viruses, including PMV, may use different strategies for traversing major and minor veins in monocotyledonous plants, potentially requiring coordinated expression of multiple proteins encoded by a gene cluster . It's worth noting that in some Panicum viruses, capsid proteins may also contribute to both cell-to-cell and systemic movement functions, as observed with PMV CP that accumulates in cell wall and P30 fractions, which are enriched for plasmodesmata and endoplasmic reticulum .

What expression strategies are employed by Panicum viruses for movement protein production?

Panicum viruses utilize sophisticated expression strategies to produce movement proteins. PMV expresses its movement-associated proteins (p8, p6.6, p15, and CP) from a subgenomic RNA of approximately 1500 nucleotides . This expression involves complex translational control mechanisms that may include leaky scanning, non-canonical start codons, and internal ribosome entry sites (IRES) . In SPMV, expression of different protein forms can occur through leaky scanning, where ribosomes bypass upstream AUG codons to initiate translation at downstream start sites . The context surrounding start codons significantly impacts expression efficiency, as demonstrated by the G-rich region surrounding AUG2 in SPMV that interferes with translational initiation at this site in vivo .

How do genomic architecture and gene clusters influence movement protein function?

The genomic organization of Panicum viruses reveals intricate relationships between gene clusters and viral movement. In PMV, a gene cluster encoded by a subgenomic RNA is directly associated with virus movement, with p8, p6.6, and p15 proteins all contributing to cell-to-cell spread . This arrangement suggests that successful systemic infection depends on the coordinated expression of these genes. The organization of these genes on a single subgenomic RNA may facilitate their coordinated regulation and expression during infection . Research into the functional interdependence of these proteins suggests they may work together as a movement complex, with mutations in one gene potentially affecting the expression or function of others, as seen with PMV CP mutants that reduce p8 protein expression .

What protein-protein interactions are critical for movement protein function?

Movement proteins operate within a network of protein-protein interactions that are crucial for their function. Notably, research on SPMV has demonstrated that its capsid protein has the unique capacity to specifically interact with the helper virus (PMV) capsid protein . This interaction may enhance satellite virus spread and accumulation in the host. Similar interactions may occur between movement proteins and other viral or host factors. The identification of such interactions provides valuable insights into the molecular mechanisms of viral spread and may reveal targets for antiviral strategies. Immunoprecipitation experiments, as described in the SPMV research, can be effective for detecting these interactions in infected plant tissues .

How do movement proteins differentially accumulate in subcellular compartments?

The subcellular distribution of movement proteins provides important clues about their function. Research on SPMV has shown that while the full-length 17-kDa capsid protein accumulates in the cytosol as well as cell wall- and membrane-enriched fractions, a 9.4-kDa C-terminal protein exclusively cofractionates with cell wall- and membrane-enriched fractions . This differential localization suggests distinct roles for these proteins in the viral infection cycle. Similar compartment-specific accumulation has been observed with PMV movement proteins, where the p8 protein localizes to the cell wall fraction consistent with its role in cell-to-cell movement . Researchers studying recombinant movement proteins should carefully analyze the subcellular distribution patterns, as these can provide insights into protein function even before detailed functional studies are conducted.

What mutagenesis strategies are most effective for studying movement protein function?

Targeted mutagenesis approaches provide powerful tools for dissecting movement protein function. Two complementary strategies have proven particularly effective: (1) introducing premature stop codons immediately downstream of predicted start codons, and (2) modifying the AUG start codons themselves . In studies with PMV, these approaches were used to inactivate each open reading frame on the subgenomic RNA, allowing researchers to determine the contributions of individual proteins to viral replication and spread . For frameshift mutations, introducing nucleotides immediately after start codons can efficiently abolish full-length protein expression while allowing expression from downstream start sites, as demonstrated with the SPMV/U-91 mutant . When designing such mutations, researchers should consider potential effects on RNA structure and stability, as these can confound interpretations of protein function.

How should subcellular fractionation be performed to study movement protein localization?

Subcellular fractionation is an essential technique for studying movement protein localization. For Panicum virus proteins, effective fractionation protocols typically separate plant tissues into cytosolic, cell wall-, and membrane-enriched fractions . This separation allows researchers to determine where movement proteins accumulate, providing insights into their function. The method described for SPMV studies involves grinding infected tissue in a buffer containing a reducing agent and protease inhibitors, followed by differential centrifugation to separate subcellular components . When analyzing fractions, it is crucial to verify the purity of each fraction using markers for different cellular compartments. Researchers should also be aware that some movement proteins may redistribute during extraction, so complementary approaches such as in situ immunolocalization or fluorescent protein tagging should be considered to confirm localization patterns.

What are the key considerations when expressing recombinant movement proteins?

When expressing recombinant movement proteins for functional studies, several factors must be considered. The solubility of these proteins can vary significantly, as observed with SPMV where differences in solubility between the full-length protein and its C-terminal product were noted . Expression systems should be selected based on the intended downstream applications, with bacterial systems suitable for producing proteins for antibody generation or in vitro binding studies, while plant-based expression may be more appropriate for functional studies. If studying protein-protein interactions, co-expression with potential interaction partners may enhance solubility and stability. For proteins like the PMV p8, which localizes to the cell wall , extraction conditions need to be optimized to efficiently recover the protein from this fraction. Additionally, researchers should verify that recombinant proteins retain their biological activity, possibly through complementation assays with movement-defective viral mutants.

What approaches help resolve conflicting data about movement protein function?

When faced with conflicting data about movement protein function, systematic analysis of protein expression, localization, and activity is essential. In cases like the PMV p15aug– mutant, which showed delayed but eventual systemic infection despite mutation of the start codon, further investigation revealed that low levels of expression may occur from a suboptimal start codon context or through leaky scanning to a second in-frame AUG codon . Quantitative analysis of protein levels in different tissues and at different time points can help resolve such discrepancies. Sequence context effects should be carefully considered when interpreting mutation studies, as seen with SPMV where the G-rich region surrounding one start codon significantly affected translation efficiency . Additionally, host-specific effects may play a role, as observed with SPMV 5′-UTR deletions that had host-specific effects on movement . Researchers should therefore test mutants in multiple host species when possible.

How can comparative analysis enhance understanding of movement protein function?

Comparative analysis across different viral systems provides valuable context for interpreting movement protein function. Within the Tombusviridae family, comparison of PMV movement proteins with those of related viruses revealed conserved localization patterns and functional properties . For example, the preferential localization of the PMV 8-kDa protein to the cell wall is similar to known cell-to-cell movement proteins of TNV-D and TCV . When studying a specific movement protein, researchers should compare its sequence, structure, and behavior with well-characterized movement proteins from related viruses. This approach can highlight conserved functional domains and mechanisms as well as unique features that may reflect host adaptation. Phylogenetic analysis of movement protein sequences can also reveal evolutionary relationships and functional conservation, providing testable hypotheses about protein function and mechanism.

What emerging technologies show promise for movement protein research?

Advanced imaging technologies offer exciting opportunities for movement protein research. Super-resolution microscopy techniques now enable visualization of protein distributions at nanometer resolution, potentially allowing researchers to observe how movement proteins interact with and modify plasmodesmata structures. Cryo-electron microscopy could reveal the structural details of movement protein complexes with viral RNA or host factors. For functional studies, optogenetic approaches that allow light-controlled activation or inhibition of protein function could enable temporal control over movement protein activity during infection. CRISPR-Cas genome editing of host plants provides new avenues for investigating how movement proteins interact with specific host factors. These technologies, combined with traditional biochemical and molecular approaches, promise to deepen our understanding of the complex mechanisms by which viral movement proteins facilitate infection spread.

How might knowledge of movement proteins inform antiviral strategies?

Understanding the mechanisms of viral movement proteins opens possibilities for novel antiviral approaches. Since movement proteins are essential for viral spread but not for replication, they represent attractive targets for strategies aimed at containing infections rather than eliminating the virus entirely. Small molecules that disrupt movement protein interactions with host factors or plasmodesmata could effectively restrict viral spread. Alternatively, expression of dominant-negative forms of movement proteins in transgenic plants might protect against viral infection by interfering with the function of viral-encoded proteins. The knowledge that some Panicum viruses require coordinated expression of multiple proteins for effective movement suggests that strategies targeting this coordinated expression, perhaps through RNA silencing approaches directed at the subgenomic RNA, might be particularly effective. As research continues to elucidate the specific host factors that interact with movement proteins, these could also become targets for breeding resistance into crop plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.