Recombinant Panthera onca Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Panthera onca MC1R

Recombinant MC1R refers to the in vitro synthesized form of the Jaguar-derived melanocortin 1 receptor, produced using E. coli expression systems. This protein retains key functional domains necessary for ligand binding and signal transduction, facilitating biochemical and pharmacological research .

Domain Architecture

  • Transmembrane Helices: 7 α-helical domains with a conserved DRY motif critical for G-protein coupling .

  • Post-Translational Modifications:

    • N-terminal glycosylation (extracellular).

    • Palmitoylation at C-terminal cysteine residues, essential for receptor trafficking and stability .

Ligand Interactions

  • Agonists: α-Melanocyte-stimulating hormone (α-MSH) activates cAMP signaling, enhancing eumelanin synthesis .

  • Antagonists: Agouti signaling protein (ASIP) inhibits MC1R, shifting melanogenesis toward pheomelanin .

UV Response and DNA Repair

MC1R signaling upregulates nucleotide excision repair (NER), mitigating UV-induced DNA damage. Recombinant MC1R studies reveal:

  • PTEN Interaction: MC1R binds PTEN phosphatase post-UV exposure, stabilizing it to suppress AKT-driven oncogenesis .

  • Chromosome Stability: MC1R deficiency correlates with centromere fragmentation and mitotic errors under UV stress .

Pharmacological Studies

  • Ligand Binding Assays: Used to screen MC1R-targeted compounds for melanoma therapy .

  • Mutation Analysis: Over 30 MC1R variants alter pigmentation and melanoma risk, modeled via recombinant proteins .

Expression and Purification

  • Vector System: pET-based plasmids with N-terminal His-tag for affinity chromatography .

  • Yield: Typical yields range 0.1–1.0 mg/mL post-reconstitution .

Functional Validation

  • cAMP Assays: Confirm receptor activation via α-MSH-induced cAMP elevation .

  • Western Blotting: Anti-His antibodies verify protein integrity .

Comparative Analysis Across Species

SpeciesMC1R CharacteristicsRelevance to Study
Homo sapiensHigh polymorphism linked to skin cancer riskTherapeutic models
Erythrocebus patasFull-length recombinant MC1R (1–317 aa) availableStructural studies
Panthera oncaPartial sequence; retains ligand-binding domainsEvolutionary conservation

Challenges and Future Directions

  • Sequence Completeness: Current Panthera onca MC1R is partial; full-length constructs are needed for structural resolution .

  • Functional Conservation: Jaguar MC1R’s role in melanogenesis vs. human homologs remains understudied .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Panthera onca (Jaguar) (Felis onca)
Target Names
Target Protein Sequence
MSVQGPQRRLLGSLNSTSPAAPRLGLAANQTGPRCLEVSVPDGLFLSLGLVSVVENVLVV AAIAKNRNLHSPMYYFICCLAVSDLLVSVSSVLETAVMLLLEAGTLAGRAAVVQQLDDVI DVLVCGAMVSSLCFLGAIAVDRYISIFYALRYHSIVTLPRAWRAISAIWVASVLSSTLFI AYYDHTAVLLCLVSFFVAMLVLMAVLYVHMLARACQHARGIARLHKRQRPVHQGLGLKGA ATLTILLGIFFLCWGPFFLHLSLMVLCPRHPICGCVFKNFNLFLTLIICNSIVDPLIYAF RSQELRKTLQEVLLCSW
Uniprot No.

Target Background

Function
This receptor acts as a mediator for Melanocyte-stimulating hormone (MSH) (alpha, beta, and gamma) and ACTH. Its activity is driven by G proteins that activate adenylate cyclase. Through regulation of cAMP signaling in melanocytes, it plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow).
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of Panthera onca MC1R?

Panthera onca (jaguar) MC1R functions as a receptor for melanocyte-stimulating hormone (MSH) in its alpha, beta, and gamma forms, as well as adrenocorticotropic hormone (ACTH). The receptor's activity is mediated through G proteins that activate adenylate cyclase, leading to increased intracellular cAMP levels. This signaling cascade regulates melanogenesis - specifically, the production of eumelanin (black/brown pigment) and phaeomelanin (red/yellow pigment) in melanocytes .

The signaling mechanism involves:

  • Ligand binding (α-MSH) to MC1R

  • G-protein activation

  • Adenylate cyclase stimulation

  • Increased cAMP production

  • Protein kinase A (PKA) activation

  • CREB phosphorylation

  • MITF regulation

  • Expression of melanogenesis-related genes

How does jaguar MC1R compare structurally to MC1R proteins in other species?

Jaguar MC1R (UniProt ID: Q865E8) shares significant structural features with MC1R from other species, particularly within the melanocortin receptor family. The protein contains the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors (GPCRs) . When comparing to human MC1R, research indicates conservation in key functional domains, particularly those involved in ligand binding and G-protein interaction.

Recent structural studies have shown that MC1R contains important extracellular and intracellular loops that mediate specific functions. Of particular note is that the second and third intercellular loops are involved in protein-protein interactions that regulate receptor trafficking and signaling. In human MC1R, these regions contain common variant sites (R151C, R160W) that affect function . Comparative analysis suggests similar functional domains exist in the jaguar receptor, though species-specific variations occur in non-conserved regions.

What expression systems are most effective for recombinant Panthera onca MC1R production?

For optimal expression of functional recombinant Panthera onca MC1R, mammalian expression systems typically yield superior results compared to bacterial or insect cell systems. This preference stems from the requirement for proper post-translational modifications, particularly palmitoylation, which has been demonstrated to be critical for MC1R trafficking and function .

Recommended expression systems:

Expression SystemAdvantagesLimitationsRecommended Application
HEK293 cellsPost-translational modifications, proper folding, high yieldHigher cost, longer production timeFunctional studies, binding assays
CHO cellsStable expression, scalability, proper foldingMedium yield, technical complexityLong-term studies, stable cell lines
Melanocyte-derived cells (e.g., A375, PIG1)Native-like environment, endogenous machineryLower yield, potential interference from endogenous MC1RTrafficking studies, signaling pathway analysis

For transient expression, vectors containing CMV promoters with fluorescent protein tags (such as mEmerald) allow for visualization of receptor localization, as demonstrated in studies with human MC1R . When conducting functional studies, it's crucial to confirm that the recombinant protein undergoes appropriate post-translational modifications, particularly palmitoylation, which regulates MC1R localization and function.

How can researchers optimize purification protocols for recombinant jaguar MC1R?

Purification of recombinant Panthera onca MC1R presents challenges common to membrane proteins. A methodological approach based on recent advances in GPCR purification includes:

  • Membrane preparation: Harvest cells expressing recombinant MC1R and disrupt using nitrogen cavitation or mechanical homogenization in a buffer containing 50 mM Tris-HCl (pH 7.4), 150 mM NaCl, and protease inhibitors.

  • Solubilization: Solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at 1-2% concentration for 2-4 hours at 4°C with gentle rotation.

  • Affinity purification: If the recombinant protein contains an affinity tag (His, FLAG, or other), use corresponding affinity chromatography. For His-tagged MC1R, immobilized metal affinity chromatography (IMAC) with Ni-NTA resin is effective.

  • Size exclusion chromatography: Further purify using size exclusion chromatography to obtain homogeneous receptor preparations and to remove aggregates.

During this process, it's critical to maintain a stable lipid environment and appropriate detergent concentration to preserve receptor functionality. Given MC1R's demonstrated interaction with the BBSome complex for ciliary localization , co-purification strategies may be necessary when studying these protein-protein interactions.

What assays are most appropriate for measuring jaguar MC1R signaling activity?

Several complementary approaches can be used to measure Panthera onca MC1R signaling activity, with cAMP detection being the primary readout since MC1R couples to adenylate cyclase through Gs proteins.

Recommended functional assays:

Assay TypeMethodologyMeasurable ParametersAdvantages
cAMP accumulationELISA, FRET-based sensors (e.g., cADDis, cAMPinG1)Total cellular cAMP levels, compartmentalized cAMP dynamicsQuantitative, can distinguish between subcellular cAMP pools
PKA activityFRET-based reporters, phosphorylation of substratesDownstream signaling activationReveals signaling cascade progression
Gene expressionqRT-PCR for melanogenesis-related genes (e.g., Sox9, MITF targets)Transcriptional response to receptor activationConnects receptor activity to biological outcomes
Melanin productionSpectrophotometric measurement of melaninFunctional endpoint of MC1R activationDirect measurement of biological effect

When designing these assays, it's critical to include appropriate controls:

  • Positive control: α-MSH stimulation of wild-type receptor

  • Negative control: Untransfected cells or cells expressing known inactive variants

  • Dose-response curves: Titration of α-MSH concentration (typically 10^-10 to 10^-6 M)

Recent studies have demonstrated that subcellular localization of MC1R significantly impacts signaling outcomes. Specifically, MC1R localized to primary cilia produces a more sustained cAMP response compared to plasma membrane-localized receptor . Therefore, measuring compartmentalized cAMP using targeted sensors provides more detailed insights into MC1R signaling dynamics.

How can researchers effectively assess ligand binding properties of recombinant jaguar MC1R?

To characterize the ligand binding properties of recombinant Panthera onca MC1R, researchers should implement multiple complementary techniques:

  • Radioligand binding assays:

    • Saturation binding using [^125I]-labeled α-MSH to determine K₁ values

    • Competition binding with unlabeled ligands to determine relative affinities

    • Association/dissociation kinetics to measure binding and unbinding rates

  • Fluorescence-based methods:

    • Fluorescently labeled ligands for direct visualization of binding

    • FRET-based approaches using tagged receptor and ligand pairs

  • Surface plasmon resonance (SPR):

    • Real-time binding kinetics

    • Label-free detection of interaction dynamics

When conducting these experiments, it's important to consider:

  • The membrane environment (detergent-solubilized vs. reconstituted)

  • The potential impact of receptor palmitoylation on binding properties

  • Temperature dependence of binding (physiological temperature vs. room temperature)

  • pH effects on ligand-receptor interactions

Data analysis should include calculation of binding constants (K₁, k_on, k_off) and comparison with MC1R from other species to identify conserved and divergent binding properties. This comparative approach can provide insights into species-specific adaptations in melanin regulation.

How do post-translational modifications affect jaguar MC1R function and localization?

Post-translational modifications (PTMs) play crucial roles in regulating Panthera onca MC1R function, with palmitoylation emerging as particularly important. Research on MC1R indicates that:

  • Palmitoylation:

    • Critical for ciliary localization of MC1R

    • Required for interaction with the BBSome complex

    • Regulated by UV/α-MSH stimulation

    • May be differentially regulated in variant forms of the receptor

The mechanism underlying palmitoylation-dependent localization involves:

  • UV/α-MSH stimulation promoting MC1R palmitoylation

  • Palmitoylated MC1R interacting with the BBSome through the second/third intercellular loops

  • BBSome facilitating trafficking of MC1R to the primary cilium

  • Ciliary MC1R triggering sustained cAMP signaling

This process appears to be conserved across species, suggesting jaguar MC1R likely undergoes similar modifications. Researchers working with recombinant jaguar MC1R should consider incorporating palmitoylation analysis into their experimental design, particularly when studying receptor trafficking and signaling.

To assess palmitoylation experimentally, techniques such as acyl-biotin exchange (ABE), metabolic labeling with palmitate analogs, or mass spectrometry analysis can be employed.

What structural domains of jaguar MC1R are critical for ligand binding and signaling?

Based on structural and functional studies of MC1R, several key domains can be identified as critical for Panthera onca MC1R function:

  • Ligand binding domains:

    • N-terminal extracellular domain: Initial recognition of α-MSH

    • Transmembrane helices (especially TM2, TM3, TM6, and TM7): Form the ligand binding pocket

    • Extracellular loops: Contribute to ligand selectivity

  • G-protein coupling domains:

    • Intracellular loops (especially ICL2 and ICL3): Interact with G proteins

    • C-terminal domain: Regulates signaling efficiency

  • BBSome interaction motifs:

    • Second/third intercellular loops: Mediate interaction with BBS2 component of the BBSome

    • These regions contain residues (corresponding to human R151 and R160) that are critical for proper trafficking

  • Palmitoylation sites:

    • Cysteine residues that undergo palmitoylation, regulating receptor trafficking and function

Comparative analysis with human MC1R variants suggests that mutations in these key domains can significantly impact receptor function. For example, variants in the second intercellular loop (R151C, R160W in humans) show reduced BBSome binding, impaired ciliary localization, and consequently altered signaling properties . Researchers working with jaguar MC1R should focus on these domains when designing mutagenesis studies or developing receptor modulators.

How can primary cilia localization of MC1R be leveraged in jaguar melanogenesis research?

Recent discoveries regarding primary cilia localization of MC1R open new avenues for exploring melanogenesis regulation in Panthera onca. Research has demonstrated that:

  • UV/α-MSH stimulation promotes ciliogenesis during melanogenesis initiation

  • MC1R localizes to primary cilia in a palmitoylation-dependent manner

  • Ciliary MC1R generates sustained cAMP signaling compared to plasma membrane-localized receptor

  • This compartmentalized signaling selectively upregulates specific melanogenesis genes, such as Sox9

For jaguar MC1R research, these findings suggest several experimental approaches:

Primary cilia visualization in jaguar melanocytes:

  • Immunofluorescence using ciliary markers (acetylated α-tubulin, Arl13b)

  • Live-cell imaging with fluorescently tagged ciliary proteins

  • Electron microscopy for ultrastructural analysis

Ciliary localization analysis:

  • Expression of fluorescently tagged recombinant jaguar MC1R (e.g., MC1R-mEmerald)

  • Quantification of ciliary enrichment under various stimulation conditions

  • Comparison with plasma membrane distribution

Compartmentalized signaling measurement:

  • Use of ciliary-targeted cAMP sensors (cADDis, cAMPinG1)

  • Comparison of ciliary vs. cytosolic cAMP dynamics

  • Correlation with melanogenesis outcomes

This ciliary-focused approach provides a novel framework for understanding species-specific adaptations in pigmentation and could explain unique coat pattern development in jaguars.

What comparative approaches can reveal evolutionary adaptations in jaguar MC1R function?

Comparative analysis of Panthera onca MC1R with orthologs from other species can provide insights into evolutionary adaptations related to coat coloration patterns. Methodological approaches include:

  • Sequence-based comparative analysis:

    • Multiple sequence alignment of MC1R sequences across felids and other mammals

    • Identification of conserved functional domains versus variable regions

    • Detection of sites under positive selection using dN/dS analysis

  • Functional comparative studies:

    • Parallel expression of MC1R from multiple felid species (e.g., jaguar, tiger, leopard)

    • Comparative ligand binding and signaling assays

    • Assessment of ciliary localization efficiency across species

  • Ecological correlation:

    • Mapping MC1R sequence variations to coat pattern phenotypes

    • Correlation with habitat types and environmental pressures

    • Comparison with melanogenic patterns in domestic cats with known MC1R variants

A particularly valuable approach would be to investigate whether differences in ciliary localization efficiency or compartmentalized signaling correlate with species-specific coat patterns. The recent finding that ciliary MC1R generates distinct signaling outcomes compared to plasma membrane MC1R suggests a potential mechanism for fine-tuning melanogenesis that may contribute to the complex rosette patterns characteristic of jaguars.

How can researchers overcome challenges in studying ciliary localization of recombinant jaguar MC1R?

Studying ciliary localization of recombinant Panthera onca MC1R presents several technical challenges. Based on recent advances in MC1R research, the following methodological approaches are recommended:

  • Optimizing ciliogenesis conditions:

    • Serum starvation (0.5% FBS for 24-48h) to promote primary cilium formation

    • Combined UV irradiation and α-MSH treatment to stimulate ciliary localization

    • Culture on fibronectin-coated surfaces to enhance cell adhesion and cilium formation

  • Enhancing visualization of ciliary MC1R:

    • Use of high-resolution imaging techniques (confocal, STED, SIM)

    • Co-expression of ciliary markers (Arl13b, acetylated α-tubulin)

    • Creation of MC1R-fluorescent protein fusions that maintain functionality

  • Developing quantitative analysis methods:

    • Calculation of ciliary enrichment ratios by normalizing ciliary fluorescence to cytoplasmic signals

    • Automated image analysis for unbiased quantification

    • Time-lapse imaging to track dynamic receptor movement

  • Controlling for potential artifacts:

    • Use ciliary localization-deficient constructs as negative controls (e.g., MC1R fused to Arl13b V359A)

    • Compare native vs. overexpressed receptor localization patterns

    • Validate findings using complementary approaches (immunogold EM, biochemical fractionation)

When troubleshooting poor ciliary localization, researchers should consider:

  • Confirming proper palmitoylation status of the recombinant receptor

  • Verifying BBSome complex expression in the host cell system

  • Testing different stimulation protocols (duration, intensity of UV exposure, concentration of α-MSH)

What strategies can address challenges in measuring compartmentalized cAMP signaling from jaguar MC1R?

Measuring compartmentalized cAMP signaling from Panthera onca MC1R requires specialized approaches to distinguish between different subcellular signaling pools. Based on recent advances in the field, researchers should consider:

  • Selection of appropriate cAMP sensors:

    • Ciliary-targeted sensors (cADDis, cAMPinG1) for primary cilium-specific measurements

    • Plasma membrane-targeted sensors for non-ciliary signaling

    • Ratiometric sensors to control for expression level variations

  • Optimizing temporal resolution:

    • High-speed confocal or TIRF microscopy for rapid dynamics

    • Time-course experiments to capture the sustained cAMP signaling characteristic of ciliary MC1R

    • Synchronized cell populations for consistency

  • Spatial resolution considerations:

    • 3D imaging to fully capture the ciliary compartment

    • Deconvolution algorithms to enhance signal discrimination

    • Careful background subtraction to account for cytoplasmic signal contamination

  • Data normalization and analysis:

    • Normalization to ciliary marker intensity

    • Calculation of fold-change relative to baseline

    • Area-under-curve analysis for sustained signaling quantification

When comparing ciliary versus plasma membrane signaling, researchers should account for:

  • The different surface-to-volume ratios of these compartments

  • Potential differences in cAMP diffusion rates

  • Variations in local phosphodiesterase activity that may regulate cAMP levels

By implementing these approaches, researchers can characterize the unique signaling properties of jaguar MC1R in different subcellular compartments and correlate these with melanogenic outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.