Recombinant Papaya mosaic potexvirus Movement protein TGB2 (ORF3)
Description
Introduction to Papaya Mosaic Potexvirus and the Triple Gene Block
Papaya mosaic virus (PMV) belongs to the genus Potexvirus within the Alphaflexiviridae family. Like other potexviruses, PMV contains a monopartite positive-sense RNA genome organized into five open reading frames (ORFs) . This genomic organization includes ORF1, which encodes the RNA-dependent RNA polymerase (RdRp), followed by three partially overlapping ORFs collectively known as the Triple Gene Block (TGB), and finally ORF5, which encodes the coat protein .
The TGB represents a specialized module that facilitates viral movement between plant cells and is found in several groups of plant viruses. Within the potexvirus genome, ORF2, ORF3, and ORF4 encode the three TGB proteins: TGB1, TGB2, and TGB3, respectively . These proteins function cooperatively to facilitate viral movement across cellular boundaries through plasmodesmata, the intercellular channels connecting plant cells .
Significance of Movement Proteins in Plant Viruses
Movement proteins (MPs) are essential components in the viral infection cycle of plants. Most plant viruses encode MPs that specifically target plasmodesmata to enable cell-to-cell and systemic spread throughout infected plants . The discovery of small membrane-embedded MPs, including TGB2 and TGB3, revealed that movement gene modules typically comprise a nucleic acid-binding protein and at least one membrane-bound movement protein . This architectural arrangement is critical for the successful translocation of viral genetic material between plant cells.
Molecular Properties
The TGB2 protein of Papaya mosaic potexvirus has a molecular weight of approximately 12 kDa, earning it the alternative name "12 kDa protein" . As a membrane-associated protein, TGB2 contains hydrophobic domains that enable its integration into cellular membranes, a characteristic essential for its function in viral movement .
Table 1: Key Molecular Properties of Recombinant PMV TGB2 Protein
Mechanism of Action in Viral Movement
The TGB2 protein of Papaya mosaic potexvirus plays a crucial role in the intracellular transport of viral genomes. As part of the Triple Gene Block, TGB2 works in concert with TGB1 and TGB3 to facilitate the movement of viral RNA through plasmodesmata, the intercellular channels connecting plant cells .
While TGB1 proteins generally function as RNA helicases with RNA-binding capabilities, TGB2 proteins like the one from Papaya mosaic potexvirus are small hydrophobic proteins that associate with cellular membranes . This membrane association is critical for the formation of viral movement complexes that transport viral RNA between cells.
Interaction with Host Cell Components
TGB2 proteins interact with host cell membranes and are believed to facilitate the formation of viral replication complexes (VRCs) . These interactions with cellular components are essential for establishing the infrastructure necessary for viral genome replication and subsequent movement. The membrane-association properties of TGB2 enable it to modify cellular membranes to create protected environments for viral replication and assembly .
Expression Systems and Methodologies
Recombinant Papaya mosaic potexvirus Movement protein TGB2 (ORF3) is typically produced using various expression systems, including:
-
Bacterial expression (E. coli): Most commonly used due to its simplicity and cost-effectiveness
-
Yeast expression systems: Offers post-translational modifications
-
Baculovirus expression systems: Used for higher eukaryotic protein processing
-
Mammalian cell expression: Provides the most authentic post-translational modifications
For research applications, the recombinant protein is usually expressed with an N-terminal His-tag to facilitate purification .
Purification and Quality Assessment
After expression, the recombinant protein undergoes purification processes, typically involving affinity chromatography leveraging the His-tag if present . The purified protein is assessed for quality using SDS-PAGE, with commercial preparations generally achieving greater than 85-90% purity .
Table 2: Recombinant Production Specifications
Buffer Conditions and Reconstitution
For optimal stability, the recombinant protein is stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . After reconstitution, it is recommended to add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage at -20°C/-80°C .
Fundamental Research on Viral Movement Mechanisms
Recombinant Papaya mosaic potexvirus Movement protein TGB2 (ORF3) serves as a valuable tool in understanding the mechanisms of viral cell-to-cell movement in plants. By studying this protein in isolation or in combination with other viral components, researchers can elucidate the complex processes involved in viral infection and spread .
Development of Antiviral Strategies
Understanding the structure and function of viral movement proteins like TGB2 provides opportunities for developing targeted antiviral strategies. By identifying key interactions between viral movement proteins and host components, researchers can design interventions that disrupt viral spread, potentially leading to new approaches for controlling viral diseases in economically important crop plants .
Sequence Conservation Among Potexviruses
TGB2 proteins from different potexviruses show varying degrees of sequence conservation. Comparative analysis reveals that TGB2 is one of the less conserved TGB genes, with nucleotide identities typically ranging from 56% to 58% between different potexvirus species . This variation suggests adaptation to specific host environments and potential functional specialization.
Functional Similarities and Differences
Table 3: Comparison of TGB2 Proteins from Selected Potexviruses
Interaction Studies with Host Factors
Identifying host factors that interact with PMV TGB2 represents another important research direction. Techniques such as yeast two-hybrid screening, co-immunoprecipitation, and mass spectrometry could reveal novel host proteins that interact with TGB2, potentially providing new targets for antiviral intervention .
Product Specs
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare according to your request.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Target Background
KEGG: vg:1494023
Q&A
What is the basic structure of recombinant Papaya mosaic potexvirus Movement protein TGB2 (ORF3)?
Recombinant PapMV TGB2 (ORF3) is a small hydrophobic protein consisting of 111 amino acids with the sequence: MSSHQNFLTPPPDHSKAILAVAVGVGLAIVLHFSLSYKLPSPGDNIHSLPFGGTYRDGTKSIIYNSPHRGPGQSGALPIITVFAIIECTLHVLRKRDNPVRPQHSDCPNCS. When produced recombinantly, it's typically fused to an N-terminal His tag to facilitate purification. As a membrane-associated protein, it contains hydrophobic domains that anchor it to cellular membranes, particularly the endoplasmic reticulum (ER) . The protein is part of the triple gene block (TGB) proteins that are critical for viral movement in plant tissues.
What role does TGB2 play in potexvirus infection cycles?
TGB2 functions primarily as a movement protein (MP) that facilitates cell-to-cell viral movement through plant tissues. Research indicates that TGB2 targets plasmodesmata, the cytoplasmic channels connecting adjacent plant cells, to enable intercellular transport of viral genetic material. TGB2 works in concert with other TGB proteins—specifically TGB1 (an RNA-binding helicase) and TGB3 (another small hydrophobic protein)—to form a functional complex that mediates viral movement . TGB2's membrane association is crucial for this function, as mutations disrupting membrane interactions inhibit viral movement. This protein represents a specialized adaptation that allows potexviruses to overcome cellular barriers and establish systemic infections.
How does TGB2 localize within infected plant cells?
Studies using GFP-fusion proteins have demonstrated that TGB2 primarily localizes to the endoplasmic reticulum (ER) and small granular-type vesicles within plant cells . This membrane association is critical for its function, as TGB2 is an integral ER protein. When expressed in protoplasts or plants, fluorescently tagged TGB2 exhibits a distinctive pattern of localization reflecting its association with the ER network and mobile membrane compartments. This localization pattern supports TGB2's role in facilitating the movement of viral complexes to and through plasmodesmata via the ER network, which extends through these intercellular junctions.
What are the optimal storage and handling conditions for recombinant TGB2 protein?
Recombinant TGB2 protein requires specific storage and handling protocols to maintain stability and activity. The lyophilized protein should be stored at -20°C to -80°C upon receipt, with aliquoting recommended for multiple use scenarios. Repeated freeze-thaw cycles should be avoided to prevent protein degradation. For working solutions, storage at 4°C for up to one week is appropriate .
For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, glycerol should be added to a final concentration of 5-50% (with 50% being standard) before aliquoting for storage at -20°C/-80°C. The reconstitution buffer typically consists of Tris/PBS-based buffer with 6% trehalose at pH 8.0 .
What methods can be used to study TGB2 interactions with other viral proteins?
Several methodological approaches can be employed to investigate TGB2 interactions with other viral components:
-
Co-immunoprecipitation (Co-IP): Using antibodies against TGB2 or its fusion tag to pull down protein complexes, followed by identification of binding partners through western blotting or mass spectrometry.
-
Yeast Two-Hybrid (Y2H) assays: For screening potential protein-protein interactions between TGB2 and other viral or host proteins.
-
Bimolecular Fluorescence Complementation (BiFC): By fusing fragments of fluorescent proteins to TGB2 and potential interaction partners to visualize interactions in living plant cells.
-
FRET (Förster Resonance Energy Transfer): To detect close proximity between fluorescently tagged proteins in real-time within plant cells.
-
Protein overlay assays: For direct assessment of binding between purified TGB2 and other proteins.
When studying the TGB protein complex specifically, research has shown that TGB1, TGB2, and TGB3 form a functional unit that operates collectively to facilitate viral RNA transport . The experimental design should account for the membrane-associated nature of TGB2 when studying these interactions.
How can researchers effectively express and purify recombinant TGB2 protein?
Expression and purification of recombinant TGB2 requires specialized approaches due to its hydrophobic nature:
Expression System Options:
| Expression System | Advantages | Challenges | Recommendations |
|---|---|---|---|
| E. coli | High yield, cost-effective, rapid | Membrane protein folding issues | Use BL21(DE3) strain with reduced temperature (16-20°C) |
| Insect cells | Better folding of membrane proteins | More complex, expensive | Consider for functional studies requiring native conformation |
| Plant expression | Native environment, proper folding | Lower yields, time-consuming | Best for in vivo functional studies |
Purification Protocol:
-
Express TGB2 with an N-terminal His tag in E. coli (most common approach)
-
Lyse cells using detergent-containing buffers to solubilize membrane proteins
-
Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
-
Consider size exclusion chromatography as a polishing step
The choice of detergent is critical when working with membrane proteins like TGB2. Mild non-ionic detergents such as DDM (n-Dodecyl β-D-maltoside) or LDAO (Lauryldimethylamine oxide) are often suitable for maintaining protein structure while providing sufficient solubilization.
How does TGB2 interact with plant cellular membranes to facilitate viral movement?
TGB2's interaction with cellular membranes, particularly the ER, is fundamentally important for potexvirus movement. Research indicates that TGB2 contains hydrophobic domains that allow it to integrate into ER membranes, where it appears to induce the formation of specialized vesicles involved in viral transport . These TGB2-induced vesicles are thought to carry viral components, including viral RNA-protein complexes, to plasmodesmata.
Advanced imaging techniques, including transmission electron microscopy and confocal microscopy with membrane-specific dyes, have revealed that TGB2 associates with ER membranes that extend through plasmodesmata. Mutations disrupting the membrane association domains of TGB2 inhibit virus movement, confirming the critical nature of this interaction . Additionally, research suggests that TGB2 may modify ER structure and/or plasmodesmata to increase the size exclusion limit, facilitating the passage of viral complexes between cells.
The current model proposes that TGB2 recruits viral ribonucleoprotein complexes (vRNPs) containing viral RNA and TGB1 to membranes and guides their transport to and through plasmodesmata via the ER network, thus establishing a specialized pathway for intercellular viral movement.
What is the relationship between PapMV TGB2 and host immunity during infection?
The interaction between PapMV TGB2 and host immunity represents a complex area of research with significant implications for understanding viral pathogenesis. Studies examining papaya viral interactions have revealed that PapMV infection triggers both innate and adaptive immune responses in host plants .
When PapMV infects plants before another virus (such as PRSV), an antagonistic interaction can occur that involves upregulation of RNA interference (RNAi) mechanisms, suggesting that adaptive immunity becomes involved . This indicates that TGB2, as a component of PapMV, may directly or indirectly influence host defense signaling pathways.
Transcriptomic analysis of PapMV-infected plants has shown differential expression of immune-related genes compared to plants infected with other viruses:
| Immune Response Type | PapMV Single Infection | PapMV → PRSV (Antagonism) | PapMV + PRSV (Synergism) |
|---|---|---|---|
| RNAi-mediated resistance | Upregulated | Highly upregulated | Limited upregulation |
| Dominant resistance genes | Upregulated | Upregulated | Upregulated |
| PR1 expression | Elevated | Highly elevated | Moderately elevated |
| ROS production | Increased | Significantly increased | Moderately increased |
These findings suggest that TGB2, along with other PapMV proteins, contributes to a distinct immune signature that influences the outcome of mixed infections . Understanding how TGB2 specifically interacts with host immunity components represents an important frontier in plant-virus interaction research.
How do mutations in TGB2 affect viral movement and pathogenesis?
Mutational analysis of TGB2 has provided valuable insights into structure-function relationships within this protein. Various studies have demonstrated that specific domains within TGB2 are critical for its function in viral movement:
-
Transmembrane domains: Mutations disrupting the hydrophobic regions that mediate membrane association prevent proper localization to the ER and inhibit viral movement .
-
Protein-protein interaction motifs: Amino acid substitutions in regions mediating interactions with other TGB proteins compromise the formation of functional movement complexes.
-
C-terminal region: Modifications to the C-terminus of TGB2 can affect its ability to associate with TGB3, disrupting the coordinated action of these proteins in viral transport.
Research using GFP-tagged TGB2 variants has allowed visualization of how specific mutations alter subcellular localization, providing direct evidence of the relationship between localization patterns and functional impairment .
How conserved is TGB2 structure and function across different potexviruses?
Comparative analysis of TGB2 proteins from representative potexviruses:
| Virus | TGB2 Size (aa) | Identity to PapMV TGB2 (%) | Key Conserved Features |
|---|---|---|---|
| PapMV | 111 | 100% | Two transmembrane domains, conserved central region |
| PVX (Potato virus X) | 122 | ~35% | Similar hydrophobic profile, ER localization pattern |
| BaMV (Bamboo mosaic virus) | 115 | ~40% | Conserved membrane topology, similar subcellular targeting |
| FoMV (Foxtail mosaic virus) | 113 | ~38% | Preserved hydrophobic domains, similar function |
How does PapMV TGB2 compare to movement proteins from other viral families?
Movement proteins (MPs) have evolved independently in different plant virus families, representing a fascinating case of convergent evolution toward a common function—facilitating viral spread through plant tissues. PapMV TGB2, as part of the triple gene block system, represents just one evolutionary solution to this challenge.
Comparative analysis between TGB2 and MPs from other viral families:
| Viral Family | Movement System | Key Differences from TGB2 | Functional Similarities |
|---|---|---|---|
| Potexviridae | Triple Gene Block (TGB1-3) | Multiple proteins working in concert | ER association, modification of plasmodesmata |
| Tobamovirus | Single 30K-type MP | Larger single protein, different structure | Increases plasmodesmata size exclusion limit |
| Comovirus | Movement protein tubules | Forms tubular structures through plasmodesmata | Facilitates cell-to-cell movement |
| Geminivirus | Nuclear shuttle protein and movement protein | DNA virus, nuclear localization component | Facilitates movement through plasmodesmata |
While these different MP systems vary considerably in structure and specific mechanisms, they all interact with plasmodesmata and facilitate the intercellular movement of viral genetic material. The TGB system, including TGB2, represents a more complex solution involving multiple proteins with specialized functions.
Understanding these comparative relationships helps researchers place TGB2's role in a broader evolutionary context and may suggest novel experimental approaches based on insights from other viral systems .
What are the major technical challenges in studying PapMV TGB2 function?
Researchers investigating PapMV TGB2 face several technical challenges:
-
Membrane protein purification: As a hydrophobic membrane protein, TGB2 is difficult to express and purify in its native conformation. Maintaining protein stability during purification often requires specialized detergents and buffer conditions .
-
In vitro functional assays: Developing assays that accurately mimic the in vivo environment of TGB2, particularly its association with membrane systems, presents significant challenges.
-
Visualizing protein dynamics: Tracking the real-time movement and interactions of TGB2 during infection requires advanced imaging techniques with high spatial and temporal resolution.
-
Distinguishing direct and indirect effects: Determining whether observed phenotypes result directly from TGB2 function or indirectly through its interactions with other viral or host proteins requires careful experimental design.
-
Reconstituting multiprotein complexes: The functional TGB movement complex involves multiple proteins (TGB1, TGB2, TGB3), making it challenging to reconstitute and study the complete system in vitro.
Addressing these challenges requires interdisciplinary approaches combining structural biology, biochemistry, cell biology, and advanced imaging techniques.
What emerging technologies show promise for advancing PapMV TGB2 research?
Several cutting-edge technologies are particularly promising for advancing our understanding of PapMV TGB2:
-
Cryo-electron microscopy (cryo-EM): This technique could potentially reveal the detailed structure of TGB2 in membrane environments and in complex with other viral components.
-
Single-molecule tracking: Advanced fluorescence microscopy approaches allow researchers to follow individual TGB2 molecules in living cells, revealing movement dynamics and interaction kinetics.
-
Proximity labeling techniques (BioID, APEX): These approaches can identify proteins in close proximity to TGB2 in living cells, helping map its interaction network.
-
CRISPR-based screening: Identification of host factors that interact with TGB2 using genome-wide CRISPR screens could reveal new insights into TGB2 function.
-
In situ structural techniques: Methods such as in-cell NMR and FRET-based structural sensors could provide information about TGB2 conformation in its native cellular environment.
-
Artificial membrane systems: Reconstitution of TGB2 in synthetic membrane systems, such as nanodiscs or liposomes, offers controlled environments for functional studies.
These technologies promise to overcome current limitations in understanding TGB2 function and may reveal new aspects of potexvirus movement mechanisms, potentially leading to novel strategies for controlling viral infections in plants.
What are the most pressing unanswered questions about PapMV TGB2?
Despite significant advances in understanding PapMV TGB2, several critical questions remain unanswered:
-
Structural details: What is the high-resolution structure of TGB2, particularly in membrane environments? How does this structure change during different stages of viral infection?
-
Host protein interactions: Which specific host proteins interact with TGB2, and how do these interactions facilitate or restrict viral movement?
-
Regulatory mechanisms: How is TGB2 function regulated during infection? Are there post-translational modifications that affect its activity?
-
Evolution and adaptation: How has TGB2 evolved to adapt to different host species? What specific features determine host range restrictions?
-
Role in immune responses: Does TGB2 have specific functions in modulating host immune responses? How does it contribute to the antagonistic effects observed in mixed infections ?
-
Therapeutic targeting: Can TGB2 function be specifically disrupted as a strategy to prevent viral spread without affecting plant physiology?
-
Systems biology perspective: How does TGB2 function integrate into the broader network of virus-host interactions during infection?
Addressing these questions will require integrative approaches combining structural, biochemical, genetic, and systems-level analyses, potentially leading to breakthroughs in understanding potexvirus pathogenesis and developing resistance strategies.
