Recombinant Papio anubis C-C chemokine receptor type 5 (CCR5)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Papio anubis CCR5 is a 352-amino-acid G protein-coupled receptor (GPCR) expressed in Escherichia coli and fused with an N-terminal polyhistidine (His) tag for purification . It replicates the native CCR5 protein (UniProt ID: P68269) found in olive baboons, a primate species used in HIV research due to its genetic similarity to humans . CCR5 serves as a coreceptor for macrophage-tropic HIV-1 strains and regulates immune cell migration via interactions with chemokines like CCL3, CCL4, and CCL5 .

Expression and Purification

The recombinant protein is produced in E. coli and purified via affinity chromatography using its His tag. Key quality metrics include:

ParameterSpecification
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol recommended for storage

HIV Coreceptor Activity

  • Comparative Efficiency: Papio anubis CCR5 shows 97% amino acid identity to human CCR5 but mediates HIV-1 fusion 20–30% less efficiently in cell-cell fusion assays .

  • Critical Residues: Polymorphisms in the N-terminal domain (e.g., residue Q8) and ECL2 (e.g., S179) reduce HIV gp120 binding compared to human CCR5 .

Immune Signaling

  • Chemokine Binding: Interacts with CCL5 via a two-site model: the N-loop docks at the receptor’s N-terminus (CRS1), while the chemokine’s N-terminus engages the transmembrane pocket (CRS2) .

  • Membrane Dynamics: CCR5 clustering in lipid rafts enhances CD4 colocalization, facilitating viral entry .

Applications in Research

  1. HIV Entry Studies: Used to investigate coreceptor tropism and resistance mechanisms .

  2. Drug Development: Screens for CCR5 antagonists like maraviroc, which mimics chemokine binding to block HIV .

  3. Structural Biology: Cryo-EM studies reveal interactions with chemokines and viral glycoproteins .

Table: Functional Comparisons of Primate CCR5

SpeciesHIV Fusion EfficiencyKey PolymorphismsStudy
Papio anubis (Olive baboon)LowN-terminal Q8, ECL2 S179Mburu (2013)
HumanHighWild-typeBlanpain et al. (1999)
Sooty mangabeyResistantCCR5Δ24 deletion allelePubMed (1998)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CCR5; CMKBR5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CD antigen CD195
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Papio anubis (Olive baboon)
Target Names
Target Protein Sequence
MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Uniprot No.

Target Background

Function
This receptor binds to various inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES. It subsequently transduces a signal by elevating intracellular calcium ion levels. This receptor may play a role in controlling granulocytic lineage proliferation or differentiation. It also participates in T-lymphocyte migration to infection sites by acting as a chemotactic receptor.
Database Links

UniGene: Pan.11143

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Papio anubis CCR5 and how does it compare to human CCR5?

Papio anubis (olive baboon) CCR5 is a G protein-coupled receptor that functions as a chemokine receptor in the immune system. Comparative analysis shows that Papio anubis CCR5 shares approximately 97% amino acid identity with human CCR5, suggesting significant structural and functional conservation . Despite this high sequence similarity, functional studies have demonstrated important differences in how these receptors interact with viral envelope proteins, particularly those of HIV-1 .

What methods are used for expressing and purifying recombinant Papio anubis CCR5?

Recombinant Papio anubis CCR5 can be expressed using several expression systems:

  • Mammalian cell expression systems: HEK293 or CHO cells are often preferred for proper post-translational modifications and trafficking to the cell membrane.

  • Yeast expression systems: Similar to methods used for other CCR5 variants, Pichia pastoris can be utilized as shown in case studies with human CCR5 .

  • Cell-free expression systems: These provide advantages for membrane proteins like CCR5 by avoiding toxicity issues associated with overexpression .

Purification typically follows a multi-step process:

  • Detergent solubilization (commonly using n-dodecyl-β-D-maltoside or CHAPSO)

  • Affinity chromatography (using engineered tags such as His6 or FLAG)

  • Size exclusion chromatography

  • Validation by SDS-PAGE, Western blotting, and functional assays

Maintaining protein stability during purification remains challenging, requiring careful optimization of detergent types and concentrations, buffer compositions, and temperature conditions throughout the process.

What functional assays are used to validate recombinant Papio anubis CCR5 activity?

Several complementary approaches can validate the functional integrity of recombinant Papio anubis CCR5:

  • Ligand binding assays: Using fluorescently labeled or radiolabeled CCR5 ligands (CCL3, CCL4, CCL5) to measure binding affinity and specificity.

  • Cell-cell fusion assays: Reporter gene-based fusion assays have been used to assess the efficiency of HIV-1 envelope-mediated fusion facilitated by various primate CCR5 molecules, including Papio anubis CCR5 .

  • G protein activation assays: Measuring downstream signaling events such as calcium flux, cAMP modulation, or ERK phosphorylation.

  • Surface plasmon resonance (SPR): For quantitative measurements of binding kinetics between CCR5 and its ligands or HIV envelope proteins.

  • Competition binding assays: Using unlabeled competitors to determine relative binding affinities, similar to approaches used in studying other CCR5 variants .

How does Papio anubis CCR5 compare functionally to CCR5 from other African primate species?

Research comparing CCR5 from three East African primate species (Papio anubis anubis, Colobus guereza, and Cercopithecus neglectus) has revealed significant functional differences despite high sequence similarity (97% identity to human CCR5 at the amino acid level for all three) .

When tested in HIV-1 envelope-mediated cell fusion assays, CCR5 molecules from these primates demonstrated varying efficiencies in facilitating viral entry. Remarkably, CCR5 from Colobus guereza (colobus monkey) and Cercopithecus neglectus (de Brazza's monkey) showed enhanced efficiency in mediating HIV-1 envelope-dependent fusion compared to human CCR5, while Papio anubis CCR5 showed a different pattern of activity .

These functional differences likely reflect subtle structural variations in the extracellular domains or transmembrane regions that affect interaction with the HIV-1 envelope glycoprotein, suggesting that small sequence variations can significantly impact coreceptor function in viral entry processes.

What is known about CCR5 polymorphisms in Papio anubis populations and their functional implications?

Unlike humans with the CCR5-Δ32 deletion (prevalent in Eurasian populations at frequencies of 0%-14%) or certain Cercocebus species with the CCR5-Δ24 deletion, comprehensive studies of CCR5 polymorphisms specifically in Papio anubis populations have been limited .

Current research has not identified dominant loss-of-function mutations in Papio anubis CCR5 comparable to the CCR5-Δ32 in humans or CCR5-Δ24 in red-capped mangabeys. This suggests that selective pressure from lentiviral infections may have differed across primate lineages, resulting in distinct evolutionary adaptations.

The absence of widespread CCR5 null mutations in baboon populations might indicate alternative mechanisms of resistance to SIV infection or different evolutionary history of host-pathogen interactions compared to other primate species where such mutations are common .

What approaches are used to study the evolutionary relationship between Papio anubis CCR5 and other primate CCR5 variants?

Evolutionary studies of primate CCR5 variants typically employ multiple complementary approaches:

  • Comparative genomics: Sequence alignment and phylogenetic analysis of CCR5 coding regions across primate species to identify conserved and divergent regions.

  • Selection pressure analysis: Calculating the ratio of nonsynonymous to synonymous substitutions (dN/dS) to identify regions under positive or purifying selection.

  • Ancestral sequence reconstruction: Computational methods to infer ancestral CCR5 sequences at different nodes of the primate phylogenetic tree.

  • Functional characterization: Testing reconstructed or contemporary CCR5 variants in cellular assays to correlate sequence differences with functional changes.

  • Molecular dating techniques: Methods similar to those used to date the CCR5-Δ32 mutation in human populations (estimated at approximately 700 years ago, with a range of 275-1,875 years) .

These approaches together provide insight into how selective pressures, potentially from ancient lentiviral infections, have shaped CCR5 evolution across different primate lineages.

How can recombinant Papio anubis CCR5 contribute to HIV entry inhibitor research?

Recombinant Papio anubis CCR5 offers valuable research applications for HIV entry inhibitor development:

  • Comparative binding studies: By comparing how entry inhibitors interact with human versus Papio anubis CCR5, researchers can identify conserved binding sites that might be less susceptible to resistance mutations.

  • Structure-function analysis: Chimeric receptors combining domains from human and Papio anubis CCR5 help map critical regions for inhibitor binding and efficacy.

  • Cross-species inhibitor testing: Evaluating whether CCR5 antagonists developed for human CCR5 (like Maraviroc) have similar effects on Papio anubis CCR5 can inform drug optimization.

  • Alternative binding pocket identification: Structural differences between human and baboon CCR5 may reveal novel binding sites for inhibitor development.

  • Resistance pathway prediction: By studying how viral envelopes adapt to utilize Papio anubis CCR5, researchers can anticipate potential resistance mechanisms against CCR5-targeted drugs.

These applications contribute to broader understanding of the structural determinants of CCR5-HIV interactions and may inspire novel approaches to blocking HIV entry.

What methodological considerations are important when using Papio anubis CCR5 in HIV coreceptor studies?

When conducting HIV coreceptor studies with Papio anubis CCR5, researchers should consider:

  • Expression level standardization: Ensuring comparable expression levels between human and Papio anubis CCR5 in experimental systems to avoid artifacts from expression differences.

  • Post-translational modification assessment: Evaluating whether tyrosine sulfation patterns, which are crucial for chemokine binding, are consistent between expression systems and natural cellular contexts .

  • Cell type considerations: The cellular background may affect CCR5 function through differential expression of interacting proteins or signaling components.

  • Viral strain selection: Different HIV-1 strains and their envelope proteins may interact differently with Papio anubis CCR5 compared to human CCR5.

  • Fusion assay optimization: As demonstrated in studies comparing primate CCR5 molecules, cell-cell fusion assays require careful optimization to accurately measure coreceptor efficiency .

  • Lipid environment control: The lipid composition significantly impacts CCR5 conformation and ligand binding properties, as shown in studies with human CCR5 and cholesterol .

How does the efficiency of HIV-1 entry mediated by Papio anubis CCR5 compare to human CCR5?

Studies examining HIV-1 entry efficiency mediated by different primate CCR5 molecules have revealed interesting species-specific differences. While specific comparative data for Papio anubis CCR5 versus human CCR5 was not fully detailed in the search results, research with East African primates including Papio anubis showed significant variation in HIV-1 envelope-mediated fusion efficiency despite high sequence similarity .

Research has demonstrated that some simian CCR5 molecules (specifically from Colobus guereza and Cercopithecus neglectus) showed enhanced efficiency in mediating HIV-1 envelope-dependent fusion compared to human CCR5 . This suggests that small sequence variations can have substantial functional consequences for viral entry.

The molecular basis for these differences likely involves specific amino acid variations in the extracellular domains or transmembrane regions that interact with the HIV-1 envelope glycoprotein. Detailed structure-function studies mapping these critical residues would provide valuable insight into the determinants of coreceptor efficiency.

What are the current approaches for studying CCR5 structure using recombinant proteins?

Advanced structural biology approaches for studying recombinant CCR5 include:

  • X-ray crystallography: Requiring stabilization of the receptor, often through:

    • Introduction of thermostabilizing mutations

    • Fusion with crystallization-promoting partners

    • Binding with stabilizing antibody fragments

  • Cryo-electron microscopy (Cryo-EM): Becoming increasingly valuable for membrane proteins like CCR5, especially when:

    • Complexed with binding partners that increase size

    • Incorporated into nanodiscs to maintain native-like lipid environment

  • Nuclear Magnetic Resonance (NMR) spectroscopy: For studying:

    • Dynamics of specific receptor domains

    • Ligand binding interactions

    • Conformational changes upon activation

  • Molecular dynamics simulations: Complementing experimental approaches by:

    • Modeling receptor behavior in various lipid environments

    • Simulating interactions with ligands and viral proteins

    • Predicting effects of species-specific sequence variations

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): For mapping:

    • Regions of conformational flexibility

    • Ligand-induced structural changes

    • Species-specific differences in dynamics

How can CRISPR-Cas9 technology be applied in Papio anubis CCR5 research?

CRISPR-Cas9 technology offers powerful applications for Papio anubis CCR5 research:

  • Gene editing in cellular models:

    • Creating knock-out models to study CCR5 function

    • Introducing specific mutations to mimic polymorphisms

    • Generating humanized CCR5 in baboon cells or baboon CCR5 in human cells

  • Domain swapping experiments:

    • Precise replacement of specific domains between human and Papio anubis CCR5

    • Creating chimeric receptors to map functional regions

  • Reporter systems:

    • Introducing fluorescent tags at the CCR5 locus to monitor expression and trafficking

    • Creating sensitive readouts for receptor activation

  • Therapeutic research applications:

    • Testing CCR5 modification strategies in baboon cells as models for human therapeutic approaches

    • Exploring the feasibility of approaches similar to those used in macaque models, where CRISPR-Cas9 has been used to disrupt CCR5

  • Comparative studies:

    • Creating consistent modifications across multiple primate CCR5 genes to isolate species-specific effects

What methods are used to study the interaction between Papio anubis CCR5 and viral envelope proteins?

Researchers employ several sophisticated methods to characterize interactions between CCR5 and viral envelope proteins:

  • Surface Plasmon Resonance (SPR):

    • Quantitative measurement of binding kinetics (kon, koff, KD)

    • Comparison of envelope protein variants with wild-type and mutant receptors

    • Real-time monitoring of binding interactions

  • Cell-cell fusion assays:

    • Reporter gene-based assays measuring fusion efficiency

    • Flow cytometry-based assays quantifying membrane mixing

    • Microscopy techniques visualizing fusion events in real-time

  • Single-molecule imaging:

    • Fluorescence resonance energy transfer (FRET) to study protein-protein interactions

    • Single-particle tracking to monitor receptor dynamics before and after envelope binding

  • Biochemical cross-linking:

    • Identification of specific contact residues between CCR5 and envelope proteins

    • Mass spectrometry analysis of cross-linked complexes

  • Competition binding assays:

    • Similar to those used in studying human CCR5 interactions

    • Measuring displacement of labeled ligands by envelope proteins

What are the main difficulties in expressing functional recombinant Papio anubis CCR5?

Expression of functional recombinant Papio anubis CCR5, like other G protein-coupled receptors, presents several technical challenges:

  • Protein toxicity: Overexpression can be toxic to host cells, compromising yield and quality.
    Solution: Use inducible expression systems with tight regulation or cell-free expression systems .

  • Proper membrane insertion: Ensuring correct topology and membrane localization.
    Solution: Optimize signal sequences and use mammalian expression systems for proper trafficking.

  • Post-translational modifications: Maintaining critical modifications like tyrosine sulfation.
    Solution: Select expression systems capable of performing relevant modifications; consider enzymatic modification post-purification.

  • Protein stability: Maintaining stable, correctly folded protein during purification.
    Solution: Optimize detergent selection, use stabilizing ligands during purification, and consider nanodiscs or other membrane mimetics for final preparation.

  • Functional validation: Confirming that the recombinant protein maintains native activity.
    Solution: Implement multiple complementary functional assays including ligand binding, signaling, and viral entry studies.

How can researchers optimize lipid environments for functional studies of recombinant Papio anubis CCR5?

The lipid environment significantly impacts CCR5 function, as demonstrated in studies with human CCR5 . Researchers can optimize lipid conditions through:

  • Lipid composition screening:

    • Systematic testing of different phospholipid compositions

    • Evaluation of cholesterol content, which has been shown to considerably decrease maraviroc binding affinity to human CCR5

    • Assessment of sphingolipid effects on receptor conformation

  • Membrane mimetic systems:

    • Nanodiscs with controlled lipid composition

    • Liposomes of varying complexity

    • Lipid cubic phase formulations for structural studies

  • Native-like membranes:

    • Extraction and reconstitution in native membrane fragments

    • Expression in cell lines with modified lipid biosynthesis

    • Cell membrane-derived vesicles maintaining the original lipid environment

  • Monitoring techniques:

    • Fluorescence anisotropy to assess receptor mobility in different lipid environments

    • Hydrogen-deuterium exchange mass spectrometry to map lipid-induced conformational changes

    • Plasmon waveguide resonance to quantify binding properties in different lipid contexts

What quality control methods ensure proper folding and function of recombinant Papio anubis CCR5?

Rigorous quality control is essential for ensuring that recombinant Papio anubis CCR5 maintains its native structure and function:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal stability assays to evaluate protein folding robustness

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity

  • Ligand binding validation:

    • Saturation binding assays with known chemokine ligands

    • Competition binding with characterized antagonists

    • Comparison with binding profiles of native receptor

  • Functional assays:

    • G protein coupling efficiency measurements

    • β-arrestin recruitment assays

    • Calcium flux or other downstream signaling readouts

  • Structural integrity assessment:

    • Limited proteolysis to probe accessible regions

    • Epitope mapping with conformation-specific antibodies

    • Hydrogen-deuterium exchange patterns compared to native receptor

  • Surface expression verification (for cell-based studies):

    • Flow cytometry with conformation-specific antibodies

    • Surface biotinylation assays

    • Immunofluorescence microscopy to assess membrane localization

How might Papio anubis CCR5 research contribute to understanding resistance to lentiviral infections?

Research on Papio anubis CCR5 can provide valuable insights into lentiviral resistance mechanisms:

  • Comparative susceptibility analysis: Determining whether structural differences in Papio anubis CCR5 confer altered susceptibility to various SIV or HIV strains compared to human CCR5.

  • Alternative coreceptor usage: Investigating whether SIVs that evolved with Papio anubis developed unique coreceptor usage patterns, similar to how SIVrcm adapted to use CCR2 in response to high frequencies of CCR5-Δ24 mutation in red-capped mangabeys .

  • Post-entry restriction mechanisms: Examining whether Papio anubis has developed cellular restriction factors that complement or compensate for CCR5-mediated entry in controlling lentiviral infections.

  • Evolutionary adaptation signatures: Identifying molecular signatures of selection in the CCR5 gene and related immune components that might reflect historic lentiviral pressure.

  • Receptor signaling differences: Comparing how receptor engagement affects downstream immune signaling, potentially revealing species-specific differences in the inflammatory response to infection.

What are the implications of species-specific differences in CCR5 for developing better animal models of HIV infection?

Understanding species-specific differences in CCR5 has significant implications for developing improved animal models:

  • Model selection guidance: Identifying which primate species have CCR5 molecules functionally most similar to human CCR5 for studying HIV entry and pathogenesis.

  • Genetic modification strategies: Informing approaches to create transgenic animals expressing human CCR5 or modified versions of native CCR5.

  • Coreceptor tropism prediction: Helping predict which viral strains might successfully use CCR5 from different species, guiding viral adaptation studies.

  • Therapeutic testing relevance: Ensuring that CCR5-targeted therapies tested in animal models will provide relevant data for human applications.

  • Evolution of viral resistance: Providing insights into how HIV might evolve to overcome CCR5-targeted interventions by studying adaptation to different primate CCR5 variants.

How might comparative studies of Papio anubis CCR5 inform the development of novel HIV entry inhibitors?

Comparative studies of Papio anubis CCR5 can drive innovation in HIV entry inhibitor development:

  • Conserved pocket identification: Mapping structural elements that are conserved between human and Papio anubis CCR5 to identify druggable sites less likely to develop resistance mutations.

  • Differential binding analysis: Understanding why some inhibitors might bind differently to human versus Papio anubis CCR5 could reveal new approaches to drug design.

  • Allosteric modulation opportunities: Identifying species-specific differences in receptor dynamics that affect HIV binding could reveal novel allosteric sites for therapeutic targeting.

  • Antibody development guidance: Informing the design of broadly reactive anti-CCR5 antibodies by focusing on epitopes conserved across primate species.

  • Combined approach refinement: Supporting development of combination approaches that target multiple aspects of the entry process, such as antibody-drug conjugates that combine CCR5 antagonism with fusion inhibition .

The development of these comparative insights could ultimately lead to more robust entry inhibitors less susceptible to viral escape mutations, addressing a key challenge in current HIV therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.