Recombinant Papio anubis C-X-C chemokine receptor type 4 (CXCR4)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

The recombinant protein is lyophilized in a Tris/PBS-based buffer with 6% trehalose (pH 8.0) and exhibits high stability under recommended storage conditions :

ParameterSpecification
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage

Functional Significance

CXCR4 plays pivotal roles in:

  • Immune Regulation: Mediates leukocyte trafficking and hematopoietic stem cell homing via SDF-1 binding .

  • Cancer Metastasis: Overexpressed in multiple cancers, promoting angiogenesis and cell survival through PI3K-AKT and RAS-MAPK pathways .

  • HIV Pathogenesis: Serves as a co-receptor for X4-tropic HIV-1 entry into T-cells .

Research using recombinant Papio anubis CXCR4 has highlighted its cross-species functional conservation. For example, cytokine-treated mesenchymal stem cells (MSCs) with upregulated CXCR4 showed enhanced engraftment in murine bone marrow, underscoring its role in stem cell homing .

In Vitro Studies

  • Binding Assays: Used to study SDF-1/CXCR4 interactions in chemotaxis and signal transduction .

  • Antibody Validation: Serves as a positive control for anti-CXCR4 antibodies (e.g., ab124824) in Western blot and flow cytometry .

In Vivo Models

  • A humanized mouse model demonstrated that anti-CXCR4 therapeutics block leukocyte mobilization from bone marrow, validating its utility in drug efficacy studies .

Key Research Findings

  • Stem Cell Homing: Preclinical studies showed that CXCR4-upregulated MSCs accelerate hematopoietic recovery in NOD/SCID mice .

  • Therapeutic Targeting: Neutralizing CXCR4 with antibodies reduced metastatic potential in cancer models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR4; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; Fusin; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD antigen CD184
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Papio anubis (Olive baboon)
Target Names
Target Protein Sequence
MEGISIYTSDNYTEEMGSGDYDSIKEPCFREENAHFNRIFLPTIYSIIFLTGIVGNGLVI LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFASVSEA DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Uniprot No.

Target Background

Function
CXCR4 is a receptor for the C-X-C chemokine CXCL12/SDF-1. It transduces signals by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. It is involved in the AKT signaling cascade. CXCR4 plays a role in regulating cell migration, for example, during wound healing. It acts as a receptor for extracellular ubiquitin, leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. CXCR4 binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. It is involved in hematopoiesis and cardiac ventricular septum formation. CXCR4 also plays a critical role in vascularization of the gastrointestinal tract, likely by regulating vascular branching and/or remodeling processes in endothelial cells. It is involved in cerebellar development. In the CNS, CXCR4 could mediate hippocampal-neuron survival.
Database Links

UniGene: Pan.11144

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.

Q&A

What is CXCR4 and what is its significance in biomedical research?

CXCR4, or C-X-C chemokine receptor type 4 (also known as CD184), belongs to the seven-transmembrane G-protein coupled receptor (GPCR) family, which represents the largest class of cell surface receptors and targets for approximately 35% of all approved drugs . CXCR4 is widely expressed in multiple cell types, including hematopoietic cells, endothelial cells, neurons, and both embryonic and adult stem cells . The receptor has gained significant research attention due to its involvement in several critical biological processes and pathological conditions, including:

  • Hematopoietic stem cell mobilization and homing

  • Cancer cell migration, invasion, and metastasis

  • HIV infection as a co-receptor for viral entry

  • Embryonic development and organogenesis

  • Immune cell trafficking and inflammation

The Papio anubis (olive baboon) CXCR4 model is particularly valuable as it provides a clinically relevant nonhuman primate system that closely resembles human biology, making it ideal for translational research studies .

How does CXCR4 signaling function in normal physiological processes?

CXCR4 primarily functions through binding to its natural ligand CXCL12 (also known as stromal cell-derived factor 1 or SDF-1). This interaction triggers multiple downstream signaling cascades that regulate various cellular responses . In normal physiology, CXCR4-CXCL12 signaling functions to:

  • Maintain hematopoietic stem cell (HSC) homing to bone marrow niches

  • Direct migration of immune cells during inflammatory responses

  • Guide cell migration during embryonic development

  • Regulate tissue repair and regeneration

The signaling pathways activated by CXCR4-CXCL12 binding include:

  • RAS-MAPK-MEK1/2 pathway: Regulates cell proliferation and differentiation

  • ERK1/2 pathway: Controls cell growth and survival

  • PI3K-AKT pathway: Modulates cell metabolism and prevents apoptosis

  • NF-κB pathway: Influences inflammation and immune responses

This receptor-ligand axis establishes chemotactic gradients that direct cell migration and positioning within tissues, which is crucial for proper development and homeostasis.

How does CXCR4 expression change during hematopoietic stem cell mobilization in Papio anubis models?

Research using Papio anubis (baboon) models has revealed a dynamic and somewhat counterintuitive pattern of CXCR4 expression during growth factor-induced hematopoietic stem cell (HSC) mobilization. Studies show that during mobilization:

  • There is a consistent stepwise increase in the proportion of peripheral blood CD34+ cells that are CXCR4-negative

  • The peak number of CD34+CXCR4- cells in peripheral blood coincides with the maximum number of colony-forming cells

  • The CD34+CXCR4- population demonstrates approximately 3-fold greater cloning efficiency compared to CD34+CXCR4+ cells

  • The frequency of cobblestone area-forming cells (a measure of primitive hematopoietic progenitors) is 6 times higher in the CD34+CXCR4- population versus CD34+CXCR4+ cells

  • The most quiescent CD34+ cells, identified by low Hoechst 33342 and rhodamine 123 staining (HoLow/RhoLow), are highly enriched in the CXCR4Low/- cell population

This pattern indicates that CXCR4 expression is dynamically regulated during mobilization, with the most primitive and functionally potent HSCs often showing reduced or absent CXCR4 expression while circulating in peripheral blood. Interestingly, when these mobilized peripheral blood CD34+ cells are incubated ex vivo with growth factors for 40 hours, they begin to re-express CXCR4, suggesting that the receptor's expression is regulated by the microenvironment .

What is the relationship between CXCR4 expression and cancer progression in primate models?

Meta-analysis of 85 studies encompassing 11,032 subjects has established a significant association between CXCR4 overexpression and poorer clinical outcomes across multiple cancer types. Specifically:

Cancer TypeNumber of StudiesNumber of PatientsHazard Ratio for PFS (95% CI)Hazard Ratio for OS (95% CI)
Hematological Malignancy6-7537-7642.31 (1.33-4.02)1.93 (1.33-2.79)
Breast Cancer13-182318-41251.80 (1.31-2.45)1.58 (1.29-1.94)
Colorectal Cancer4-5263-3752.69 (1.70-4.26)1.83 (1.32-2.53)
Esophageal Cancer5-7760-8861.59 (1.24-2.05)1.65 (1.24-2.19)
Renal Cancer4-5488-5943.98 (2.26-7.01)2.93 (2.06-4.15)
Gynecologic Cancer64663.03 (1.89-4.88)Not specified
Liver Cancer22562.32 (1.73-3.10)Not specified
Head and Neck Cancer7577Not specified2.02 (1.37-2.97)

The mechanistic basis for this relationship involves CXCR4's activation of multiple pro-oncogenic pathways following binding to its ligand CXCL12, including:

  • RAS-MAPK-MEK1/2 signaling promoting cell proliferation

  • PI3K-AKT pathway inhibiting apoptosis

  • NF-κB pathway enhancing inflammation and survival

  • Various pathways supporting tumor angiogenesis, invasion, and metastasis

What experimental approaches can be used to study CXCR4 function in Papio anubis models?

Several experimental approaches have been developed to investigate CXCR4 function in Papio anubis models:

  • Flow Cytometry Analysis: Used to quantify CXCR4 expression on cell surfaces. Can be combined with other markers (e.g., CD34, Hoechst 33342, rhodamine 123) to characterize cell subpopulations with different CXCR4 expression levels .

  • In vitro Colony Formation Assays: Assesses the clonogenic potential of CXCR4+ versus CXCR4- cells by measuring colony-forming unit (CFU) frequencies in methylcellulose cultures .

  • Cobblestone Area-Forming Cell (CAFC) Assay: Evaluates the primitive hematopoietic stem cell content by co-culturing test cells with stromal layers and observing the formation of cobblestone areas .

  • Ex vivo Culture Manipulation: Studies the plasticity of CXCR4 expression by exposing cells to different cytokines or growth factors and monitoring changes in receptor expression .

  • Transplantation Studies: Determines the functional capacity of CXCR4- versus CXCR4+ cells by transplanting them into lethally irradiated recipients and measuring engraftment and hematopoietic reconstitution .

  • Pharmacological Intervention: Uses CXCR4 antagonists (e.g., plerixafor/AMD3100) to block CXCR4-CXCL12 interactions and assess the subsequent effects on cell mobilization, homing, or cancer progression .

  • Signaling Pathway Analysis: Examines downstream signaling cascades activated by CXCR4 using phospho-specific antibodies to detect activated forms of signaling molecules like ERK1/2, AKT, and NF-κB .

What are the optimal conditions for expressing and purifying recombinant Papio anubis CXCR4?

Recombinant Papio anubis CXCR4 protein is typically produced using E. coli expression systems, with the following specifications and methodological considerations:

Expression System:

  • Host: E. coli is the preferred expression system for full-length CXCR4 (1-352 amino acids)

  • Vector: Typically includes an N-terminal His-tag for purification purposes

  • Induction conditions: Optimized IPTG concentration and temperature are essential for proper expression

Purification Protocol:

  • Cell lysis: Performed under native or denaturing conditions depending on protein solubility

  • Affinity chromatography: Using Ni-NTA or similar matrices that bind the His-tag

  • Size exclusion chromatography: For further purification and buffer exchange

  • Quality control: SDS-PAGE analysis to confirm purity (>90% is standard)

Storage and Handling:

  • Form: Typically provided as lyophilized powder

  • Reconstitution: Using deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Storage buffer: Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • Addition of 5-50% glycerol (final concentration) for long-term storage

  • Storage at -20°C/-80°C with avoidance of repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

Note that membrane proteins like CXCR4 are challenging to express and purify in their native conformation, which may impact functional studies. Alternative expression systems such as mammalian or insect cells might be considered for studies requiring properly folded and post-translationally modified protein.

How can researchers effectively study CXCR4-mediated signaling pathways?

Investigating CXCR4-mediated signaling pathways requires a multi-faceted approach:

Receptor Activation Studies:

  • Stimulation with CXCL12 (SDF-1) at various concentrations and time points

  • Use of receptor-specific antagonists (e.g., AMD3100/plerixafor) as controls

  • Analysis of receptor internalization and recycling using fluorescently labeled antibodies or ligands

Signaling Pathway Analysis:

  • Western blotting with phospho-specific antibodies to detect activated forms of:

    • ERK1/2 (phospho-Thr202/Tyr204)

    • AKT (phospho-Ser473)

    • p38 MAPK (phospho-Thr180/Tyr182)

    • NF-κB p65 (phospho-Ser536)

  • Kinetic analysis (0-60 minutes post-stimulation) to capture both early and late signaling events

  • Use of pathway-specific inhibitors to dissect signaling networks:

    • U0126 or PD98059 for MEK/ERK pathway

    • LY294002 or wortmannin for PI3K/AKT pathway

    • BAY 11-7082 for NF-κB pathway

Functional Readouts:

  • Chemotaxis/migration assays using Boyden chambers or real-time cell analysis systems

  • Proliferation assays (e.g., MTT, BrdU incorporation)

  • Survival/apoptosis assays (e.g., Annexin V/PI staining, caspase activity)

  • Gene expression analysis using qRT-PCR or RNA-seq for downstream targets

Advanced Techniques:

  • BRET/FRET assays to study receptor dimerization and protein-protein interactions

  • Calcium flux measurements using fluorescent indicators (Fluo-4, Fura-2)

  • Receptor mutagenesis to identify critical residues for signaling

  • Proteomic approaches (mass spectrometry) to identify novel interacting partners or signaling components

What are the key considerations for experimental design when studying CXCR4 in cancer models?

When designing experiments to investigate CXCR4 in cancer models, researchers should consider several critical factors:

Model Selection:

  • Patient-derived xenografts may better recapitulate the heterogeneity of human tumors compared to established cell lines

  • Nonhuman primate models (e.g., Papio anubis) provide valuable translational insights due to their physiological similarity to humans

  • Genetic models with conditional CXCR4 expression can help dissect temporal aspects of receptor function

Expression Analysis:

  • Quantify both mRNA (qRT-PCR) and protein (Western blot, flow cytometry, immunohistochemistry) levels

  • Assess receptor functionality through calcium mobilization or migration assays

  • Evaluate CXCR4 expression in different tumor compartments (e.g., tumor core vs. invasive front)

  • Consider the expression of CXCL12 in the tumor microenvironment to understand the complete axis

Therapeutic Intervention Studies:

  • Include appropriate controls for CXCR4 antagonists (e.g., AMD3100/plerixafor)

  • Consider combination approaches with standard chemotherapy or targeted therapies

  • Monitor for potential mobilization of bone marrow-derived cells that might impact tumor biology

  • Assess both primary tumor growth and metastatic spread

Data Analysis and Reporting:

  • Report hazard ratios with 95% confidence intervals for survival analyses

  • Present both univariate and multivariate analyses

  • Include detailed methodology to enable reproducibility

  • Provide raw data when possible to facilitate meta-analyses

How should researchers interpret the apparent contradiction between CXCR4 expression and stem cell function?

The Papio anubis model has revealed an intriguing paradox regarding CXCR4 expression and hematopoietic stem cell (HSC) function that requires careful interpretation:

The Contradiction:
While CXCR4 is generally considered crucial for HSC homing and retention in bone marrow niches through interaction with CXCL12, studies in baboons demonstrate that:

  • The most primitive and functionally potent HSCs in mobilized peripheral blood are predominantly CXCR4-negative or low-expressing

  • These CXCR4-negative cells show higher cloning efficiency (3-fold greater) and cobblestone area-forming cell frequency (6-fold higher) than CXCR4-positive cells

  • Peripheral blood stem cell grafts consisting predominantly of CXCR4-negative cells successfully engraft in lethally irradiated baboons

Interpretative Framework:
This apparent contradiction can be explained through several mechanistic hypotheses:

  • Dynamic Regulation Hypothesis: CXCR4 expression is not static but dynamically regulated based on microenvironmental cues. The temporary downregulation of CXCR4 may facilitate mobilization from bone marrow niches, with re-expression occurring during homing and engraftment. This is supported by the observation that ex vivo incubation with growth factors for 40 hours induces CXCR4 expression in previously negative cells .

  • Functional Compensation Hypothesis: Other adhesion molecules or chemokine receptors may compensate for reduced CXCR4 expression during certain phases of HSC trafficking. These might include VLA-4, CD44, or other chemokine receptors.

  • Cell Cycle Status Correlation: CXCR4 expression may correlate with cell cycle status, with more quiescent (and potentially more primitive) HSCs expressing lower levels of the receptor. This is consistent with the finding that HoLow/RhoLow cells (indicative of quiescence) are enriched in the CXCR4Low/- population .

  • Threshold Effect Hypothesis: Even very low levels of CXCR4 (below detection thresholds of conventional assays) may be sufficient for functional responses to CXCL12 gradients during homing.

These interpretations suggest that while CXCR4-CXCL12 interaction is important for HSC biology, its role is more nuanced than previously thought, with expression levels varying according to HSC activation state and microenvironmental context.

What statistical approaches are most appropriate for analyzing CXCR4 expression data in cancer studies?

When analyzing CXCR4 expression data in cancer studies, researchers should employ robust statistical methodologies that account for the complexity of clinical datasets:

Survival Analysis Techniques:

  • Kaplan-Meier method for estimating survival functions

  • Log-rank test for comparing survival distributions between high and low CXCR4 expression groups

  • Cox proportional hazards regression for multivariate analysis, yielding hazard ratios with 95% confidence intervals

  • Time-dependent Cox models when CXCR4 expression is measured at multiple timepoints

Expression Cutoff Determination:

  • Receiver Operating Characteristic (ROC) curve analysis to identify optimal cutoff values

  • Minimum p-value approach with appropriate correction for multiple testing

  • X-tile analysis for visual identification of cutpoints with statistical significance

  • Consideration of biological relevance when establishing cutoffs

Meta-Analysis Approaches:

  • Random-effects models when significant heterogeneity exists between studies

  • Fixed-effects models when study results are relatively homogeneous

  • Forest plots to visualize effect sizes across different studies

  • Funnel plots and Egger's test to assess publication bias

Correlation Analysis:

  • Spearman or Pearson correlation to assess relationships between CXCR4 expression and continuous variables

  • Chi-square or Fisher's exact test for categorical variables

  • Multivariate regression to adjust for confounding factors

Addressing Common Statistical Challenges:

  • Multiple comparison correction (e.g., Bonferroni, Benjamini-Hochberg FDR)

  • Handling missing data (multiple imputation vs. complete case analysis)

  • Sample size considerations and power calculations

  • Sensitivity analyses to test robustness of findings

What are the emerging therapeutic applications of CXCR4 research in Papio anubis models?

Research on CXCR4 in Papio anubis models has illuminated several promising therapeutic applications:

  • Hematopoietic Stem Cell Transplantation: Understanding CXCR4 dynamics during mobilization has already contributed to the development of plerixafor (AMD3100), the first FDA-approved CXCR4 antagonist for stem cell mobilization in non-Hodgkin's lymphoma and multiple myeloma patients . Further refinement of mobilization protocols based on Papio anubis studies could enhance transplant outcomes.

  • Cancer Therapeutics: The strong correlation between CXCR4 overexpression and poor prognosis across multiple cancer types supports targeting this receptor in cancer treatment . Several approaches under investigation include:

    • Monoclonal antibodies against CXCR4

    • Small molecule CXCR4 antagonists beyond plerixafor

    • Peptide inhibitors of CXCR4-CXCL12 interaction

    • Combination therapies targeting CXCR4 alongside conventional chemotherapy or immunotherapy

  • HIV Treatment: CXCR4 serves as a co-receptor for HIV entry into cells, making it a target for anti-viral strategies. Nonhuman primate models provide valuable systems for testing such approaches .

  • Inflammatory Disorders: CXCR4 modulates immune cell trafficking and function, suggesting potential applications in autoimmune and inflammatory conditions.

Future research directions should focus on:

  • Developing tissue-specific CXCR4 targeting to minimize systemic effects

  • Understanding the dynamic regulation of CXCR4 expression in different physiological and pathological contexts

  • Exploring combination therapies that target multiple aspects of CXCR4 signaling

  • Investigating the potential of CXCR4 as a biomarker for patient stratification and treatment selection

How can researchers integrate multi-omics data to advance CXCR4 research?

Advancing CXCR4 research requires integrating data across multiple biological domains:

  • Genomics Integration:

    • Whole genome/exome sequencing to identify CXCR4 mutations or polymorphisms

    • Epigenetic profiling (DNA methylation, histone modifications) to understand CXCR4 regulation

    • Chromatin accessibility studies (ATAC-seq) to identify regulatory elements

  • Transcriptomics Approaches:

    • RNA-seq to capture CXCR4 expression patterns across cell types and conditions

    • Single-cell RNA-seq to reveal cell-specific CXCR4 expression heterogeneity

    • Alternative splicing analysis to identify functional CXCR4 isoforms

  • Proteomics Methods:

    • Mass spectrometry to identify CXCR4 post-translational modifications

    • Interactome analysis to map CXCR4 protein-protein interactions

    • Phosphoproteomics to characterize CXCR4 signaling networks

  • Metabolomics Connections:

    • Investigating metabolic alterations associated with CXCR4 signaling

    • Exploring connections between energy metabolism and CXCR4-mediated functions

  • Spatial Biology:

    • Imaging mass cytometry or spatial transcriptomics to map CXCR4 distribution in tissues

    • Understanding CXCR4 localization relative to ligands and downstream effectors

  • Computational Integration:

    • Network analysis to identify key nodes in CXCR4-associated pathways

    • Machine learning approaches to predict CXCR4-related outcomes

    • Systems biology modeling to simulate CXCR4 dynamics

  • Translational Applications:

    • Patient stratification based on integrated CXCR4 multi-omics profiles

    • Identification of novel therapeutic targets within CXCR4 networks

    • Development of predictive biomarkers for CXCR4-targeted therapies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.