Recombinant Papio anubis Fatty acid desaturase 1 (FADS1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid Metabolism

FADS1 is a Δ5-desaturase critical for converting dihomo-γ-linolenic acid (DGLA; 20:3n-6) to arachidonic acid (AA; 20:4n-6) and eicosatetraenoic acid (20:4n-3) to eicosapentaenoic acid (EPA; 20:5n-3) . This enzyme:

  • Operates in the endoplasmic reticulum as a multi-pass transmembrane protein .

  • Regulates inflammatory eicosanoid production by controlling AA levels .

  • Exhibits reduced activity in metabolic disorders like MASLD (metabolic dysfunction-associated steatotic liver disease) .

3.1. Mechanistic Studies

  • Enzyme Kinetics: Used to quantify desaturase activity via AA/DGLA ratios in lipidomics analyses .

  • Genetic Variant Effects: FADS1 SNPs (e.g., rs174550) alter PUFA metabolism and inflammatory responses, studied using recombinant proteins .

3.2. Therapeutic Development

  • Gene Therapy: Hepatocyte-specific AAV8-FADS1 overexpression in rodent models improved glucose tolerance and reduced hepatic cholesterol, highlighting its potential for treating metabolic diseases .

  • Drug Targeting: Inhibitors of FADS1 are explored to modulate AA-derived pro-inflammatory mediators .

Key Research Findings

  • Diet-Gene Interactions: The FADS1 rs174550 genotype modifies metabolic responses to high-PUFA diets, influencing AA levels and insulin sensitivity .

  • Evolutionary Significance: Positive selection in FADS1 among Europeans correlates with enhanced LC-PUFA synthesis, likely adapting to historical dietary shifts .

  • Disease Associations: Reduced FADS1 activity is linked to MASLD progression, while its overexpression reverses hepatic lipid accumulation in animal models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your specific needs.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
FADS1; Acyl-CoA; 8-3-desaturase; Delta(5 fatty acid desaturase; D5D; Delta(5 desaturase; Delta-5 desaturase; Fatty acid desaturase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Papio anubis (Olive baboon)
Target Names
FADS1
Target Protein Sequence
MAPDPVAAKTPVQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYDISEFTRRHPGGSRVIS HYAGQDATDPFVAFHSNKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVE QMGLMKANHVFFLLYLLHILLLDGAAWLTLWIFGTSFLPFLLCAVLLTAAQIQAGWLQHD LGHLSVFSTSKWNHLVHHFVIGHLKGVPASWWNHMHFQHHAKPNCFGKDPDINMHPFFFA LGKILSVELGKQKKKYMPYNHQHKYFFLIGPPALVPFFFQWYVFYFVIQRKKWVDLAWMI TFYIRLLLTYVPLLGLKAFLGLYFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQL QATCNVHKSAFNDWFSGHLNFQIEHHLFPMMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL SAFADIIHSLKESGQLWLDAYLHQ
Uniprot No.

Target Background

Function
Fatty acid desaturase 1 (FADS1) functions as a front-end fatty acyl-coenzyme A (CoA) desaturase. It introduces a cis double bond at carbon 5, located between a preexisting double bond and the carboxyl end of the fatty acyl chain. FADS1 is involved in the biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors. Specifically, it desaturates dihomo-gamma-linoleoate (DGLA) (20:3n-6) and eicosatetraenoate (ETA) (20:4n-3) to generate arachidonate (AA) (20:4n-6) and eicosapentaenoate (EPA) (20:5n-3), respectively (Probable). As a rate-limiting enzyme for DGLA (20:3n-6) and AA (20:4n-6)-derived eicosanoid biosynthesis, FADS1 controls the metabolism of inflammatory lipids like prostaglandin E2. This is crucial for efficient acute inflammatory response and the maintenance of epithelium homeostasis. FADS1 contributes to membrane phospholipid biosynthesis by providing AA (20:4n-6) as a major acyl chain esterified into phospholipids. Notably, it regulates phosphatidylinositol-4,5-bisphosphate levels, modulating inflammatory cytokine production in T-cells. FADS1 also desaturates (11E)-octadecenoate (trans-vaccenoate)(18:1n-9), a metabolite in the biohydrogenation pathway of LA (18:2n-6).; It does not exhibit any catalytic activity toward 20:3n-6, but it may enhance FADS2 activity.
Gene References Into Functions
  1. discovery and function of a novel FADS1 splice variant PMID: 22619218
Database Links

UniGene: Pan.11063

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
[Isoform 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion.; [Isoform 2]: Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Expressed in brain, liver and thymus (at protein level). Isoform 1 seems to be more abundant than isoform 2. Expression of isoform 2 is very low in spleen and not detectable in skeletal muscle.

Q&A

What is FADS1 and what is its role in fatty acid metabolism?

FADS1, also known as delta-5 desaturase (D5D), is one of the rate-limiting enzymes involved in the desaturation and elongation cascade of polyunsaturated fatty acids (PUFAs) to generate long-chain PUFAs (LC-PUFAs). It plays a crucial role in maintaining lipid homeostasis in various tissues, particularly the liver. FADS1 catalyzes the introduction of double bonds at specific positions in the carbon chain of fatty acids, which is essential for the production of physiologically important LC-PUFAs such as arachidonic acid (20:4n-6) from dihomo-gamma-linolenic acid (20:3n-6) .

The enzyme is part of a gene cluster that includes FADS2 and FADS3, with FADS1 sharing 61% identity with FADS2 and 52% identity with FADS3. The classical FADS1 transcript encodes a protein of 444 amino acids with a molecular mass of 52.0 kDa and is highly expressed in the liver, brain, and heart .

What are the known isoforms of Papio anubis FADS1 and how are they generated?

Multiple FADS1 isoforms have been identified in Papio anubis (baboon) through 5' and 3' rapid amplification of cDNA ends (RACE) using gene-specific primers. These isoforms are generated through three main mechanisms:

  • Alternative transcription initiation

  • Alternative selection of poly(A) sites

  • Internal exon deletions resulting from alternative splicing

One notable isoform is FADS1AT1, which has been functionally characterized in detail. These alternative transcripts show tissue-specific expression patterns in the baboon, similar to alternative transcripts of FADS2 and FADS3 that were previously identified .

The presence of these multiple isoforms suggests a complex regulatory network controlling FADS1 function, allowing for tissue-specific modulation of PUFA metabolism. This finding is significant because, until recently, only a single transcript had been identified for FADS1, despite its operation on both n-6 and n-3 PUFAs .

What expression systems are most effective for recombinant production of FADS1?

Based on published research, several expression systems have proven effective for the recombinant production of FADS1:

  • Mammalian Cell Expression Systems:

    • MCF7 cells have been successfully used for stable expression of FADS1 and its isoforms

    • HepG2 and HuH7 liver cell lines provide a metabolically relevant context

    • Neuroblastoma (NB) cells have been utilized for subcellular localization studies

  • Vector Systems:

    • pcDNA3.1 expression vector containing cytomegalovirus (CMV) promoter

    • pEGFP-N1 vector for creating fusion proteins with GFP tags

    • Lentiviral vectors for stable integration and expression

    • Adenoviral vectors for transient high-level expression

When preparing recombinant FADS1, researchers should consider that proper folding and potential post-translational modifications are crucial for enzymatic activity, making mammalian expression systems preferable over bacterial systems for functional studies .

What techniques can be used to measure FADS1 enzymatic activity?

Several validated techniques are available for measuring FADS1 enzymatic activity:

  • Substrate Conversion Assay:

    • Cells expressing FADS1 are incubated with substrate fatty acids (e.g., 20:3n-6)

    • After incubation (typically 24 hours), cellular lipids are extracted

    • Conversion to products (e.g., 20:4n-6) is measured by gas chromatography

    • Activity is calculated as the percentage of substrate converted to product

  • Lipidomic Analysis:

    • Targeted lipidomic profiling of phospholipids, sphingolipids, and ceramides

    • Measuring specific fatty acid ratios that reflect desaturase activity

    • Analysis of changes in lipid species composition

A typical protocol involves dosing cells with 100 μM of albumin-bound substrate fatty acid (e.g., 18:2n-6 or 20:3n-6), incubating for 24 hours, then analyzing fatty acid composition. For example, in one study, researchers measured conversion of 20:3n-6 → 20:4n-6, finding rates of 10.35 ± 0.01% in control cells versus 11.05 ± 0.04% in experimental conditions .

How should researchers design FADS1 knockdown experiments?

When designing FADS1 knockdown experiments, researchers should consider:

  • Knockdown Methods:

    • Short hairpin RNA (shRNA) delivered by lentiviral vectors for stable knockdown

    • siRNA for transient knockdown

    • CRISPR-Cas9 for complete gene knockout

  • Controls:

    • Non-targeting shRNA/siRNA controls

    • Wild-type cells or animals as baseline comparisons

    • Rescue experiments by reintroducing FADS1 to confirm specificity

  • Validation of Knockdown:

    • Western blotting to confirm reduced protein expression

    • qRT-PCR to measure mRNA levels

    • Functional assays to verify reduced enzymatic activity

  • Phenotypic Assessments:

    • Lipidomic analysis to measure changes in fatty acid composition

    • Oil Red O staining to quantify neutral lipid accumulation

    • Analysis of lipid droplet formation

    • Measurement of total triglyceride levels

  • Mechanistic Investigations:

    • Analysis of downstream pathways (e.g., PPARα-FGF21 axis)

    • Assessment of oxidative stress markers

    • Evaluation of mitochondrial function

Research has shown that FADS1 knockdown significantly reduces cellular levels of LC-PUFAs and increases lipid accumulation and lipid droplet formation in hepatic cell lines .

How does FADS1 affect the PPARα-FGF21 signaling axis?

FADS1 plays a critical role in modulating the PPARα-FGF21 signaling axis, with significant implications for hepatic lipid metabolism:

  • Molecular Mechanism:

    • FADS1 activity produces LC-PUFAs that serve as natural ligands for PPARα

    • Reduced FADS1 function leads to decreased PPARα activation

    • Impaired PPARα activation results in reduced FGF21 expression

    • FGF21 is a key metabolic regulator that promotes fatty acid oxidation

  • Experimental Evidence:

    • FADS1 knockdown significantly reduced nuclear binding to the FGF21 promoter element containing PPRE binding sequence

    • This effect was reversed by either FADS1 gene overexpression or docosahexaenoic acid (DHA) treatment

    • FADS1-knockout mice showed reduced protein expression of both PPARα and FGF21

  • Functional Consequences:

    • Decreased fatty acid oxidation

    • Increased lipogenesis

    • Enhanced lipid accumulation

    • Altered mitochondrial function

    • Exacerbation of diet-induced hepatic steatosis

This mechanism explains why FADS1 deficiency leads to hepatic lipid accumulation and why supplementation with DHA, PPARα agonists, or FGF21 can reverse these effects .

What are the effects of FADS1 genetic variants on hepatic lipid composition?

FADS1 genetic variants have significant effects on hepatic lipid composition:

  • Fatty Acid Changes:

    • Rare alleles of FADS1 SNPs are associated with accumulation of multiple long-chain fatty acids

    • These variants affect specific phospholipid species, including phosphatidylinositol (PI) C36:4 and phosphatidylethanolamine (PE) C38:3 (P < 3 × 10^-4)

    • They significantly increase ratios between more saturated and relatively less saturated forms of LCFAs (P ≤ 3.5 × 10^-6)

  • Expression Effects:

    • These alleles are associated with decreased hepatic expression of FADS1 (P = 0.0018)

    • Interestingly, they do not affect FADS2 or FADS3 expression (P > 0.05)

  • Clinical Implications:

    • The variants are associated with increased total hepatic fat content (P < 0.05)

    • This suggests a mechanism by which FADS1 polymorphisms contribute to fatty liver disease susceptibility

These findings provide insight into how FADS1 and its polymorphisms modulate hepatic lipid deposition by altering gene transcription and controlling lipid composition in human livers .

How can researchers distinguish between direct and indirect effects of FADS1 on lipid metabolism?

Distinguishing between direct and indirect effects of FADS1 on lipid metabolism requires sophisticated experimental approaches:

  • Rescue Experiments:

    • Supplementation with specific LC-PUFAs (e.g., DHA)

    • Direct activation of downstream pathways (e.g., PPARα agonists)

    • Administration of pathway end products (e.g., FGF21)

  • Pathway Analysis:

    • Sequential analysis of intermediates in the pathway

    • Temporal assessment of changes following FADS1 manipulation

    • Combined genetic and pharmacological approaches

  • Direct vs. Indirect Effects:

    • Direct effects include changes in fatty acid desaturation and membrane phospholipid composition

    • Indirect effects include alterations in gene expression regulated by PUFA-responsive transcription factors

    • The increased lipid accumulation appears to be primarily an indirect effect mediated through the PPARα-FGF21 axis

  • Experimental Evidence:
    Research has demonstrated that:

    • FADS1 knockdown reduces LC-PUFA levels (direct effect)

    • This leads to reduced PPARα activity and decreased FGF21 expression (indirect effects)

    • Treatment with DHA, PPARα agonists, or FGF21 can reverse the phenotype, confirming the indirect nature of lipid accumulation

This mechanistic understanding is crucial for developing targeted interventions for disorders involving FADS1 dysfunction .

What controls should be included in FADS1 functional studies?

Proper experimental controls are critical when studying FADS1 function:

  • Negative Controls:

    • Empty vector transfection

    • Non-targeting shRNA for knockdown studies

    • Wild-type littermates for knockout animal studies

  • Positive Controls:

    • Known FADS1 substrates (e.g., 20:3n-6)

    • Established cell lines with confirmed FADS1 activity

  • Validation Controls:

    • Rescue experiments by reintroducing wild-type FADS1

    • Treatment with end products (e.g., DHA)

    • Activation of downstream pathways (e.g., PPARα agonists)

  • Technical Controls:

    • For subcellular localization: Organelle-specific stains (e.g., MitoTracker Red CMXRos for mitochondria, ER-tracker Blue-White DPX for endoplasmic reticulum)

    • For protein expression: Western blot with organelle-specific markers (e.g., COX IV for inner mitochondrial membrane, PDI for endoplasmic reticulum)

    • For promoter binding studies: Specific and non-specific competitors in EMSA

These controls help ensure the specificity and reliability of experimental findings related to FADS1 function .

How do lipid ratios serve as biomarkers for FADS1 activity?

Specific fatty acid ratios serve as reliable biomarkers for FADS1 activity:

  • Key Ratios:

    • 20:4n-6/20:3n-6 ratio (product/substrate ratio for delta-5 desaturation)

    • C36:4/C36:3 ratio in phosphatidylinositols (PIs)

    • C38:4/C38:3 ratio in phosphatidylethanolamines (PEs)

    • C38:4/C38:3 ratio in phosphatidylcholines (PCs)

  • Directional Changes:

    • Decreased FADS1 expression or function → Decreased product/substrate ratios

    • Increased FADS1 expression or function → Increased product/substrate ratios

    • These ratios reflect the enzymatic function of FADS1 in converting substrate to product fatty acids

  • Applications:

    • Assessing the functional impact of FADS1 genetic variants

    • Monitoring the efficacy of interventions targeting FADS1 or its pathway

    • Stratifying populations based on FADS1 functional status

    • Correlating FADS1 activity with disease risk or progression

These lipid ratios provide a non-invasive means to assess FADS1 function in both research and clinical settings .

What are the key considerations for FADS1 knockout animal models?

When working with FADS1 knockout animal models, several important considerations should be addressed:

  • Model Generation:

    • Global vs. tissue-specific knockout approaches

    • Inducible systems to avoid developmental effects

    • Consideration of compensatory mechanisms

    • Careful genetic background selection

  • Dietary Factors:

    • Control of dietary PUFA content is crucial

    • High-fat diet challenges to reveal latent phenotypes

    • Consideration of essential fatty acid requirements

    • Standardized feeding protocols

  • Phenotypic Assessment:

    • Comprehensive lipidomic profiling of multiple tissues

    • Histological evaluation of lipid accumulation

    • Analysis of metabolic parameters

    • Evaluation of inflammatory markers

  • Mechanistic Investigations:

    • Analysis of PUFA-dependent signaling pathways

    • Assessment of PPARα-FGF21 axis

    • Evaluation of compensatory changes in related genes

    • Rescue experiments with specific fatty acids or agonists

  • Evidence from Animal Studies:

    • FADS1-knockout mice fed with high-fat diet develop increased hepatic steatosis compared to wild-type littermates

    • Molecular analyses show reduced protein expression of PPARα and FGF21

    • These findings corroborate observations made in cell culture models

Animal models provide valuable insights into the systemic effects of FADS1 deficiency and allow for testing interventions that might ameliorate associated metabolic disturbances .

How can findings from FADS1 studies be translated to human metabolism?

Translating findings from FADS1 studies to human metabolism requires careful consideration of several factors:

  • Species Differences:

    • Human vs. animal FADS1 activity and regulation

    • Variations in tissue expression patterns

    • Differences in dietary habits and nutrient requirements

  • Genetic Variation:

    • Human FADS1 polymorphisms and their functional impact

    • Population-specific allele frequencies

    • Interaction with environmental factors

  • Clinical Correlations:

    • Association of FADS1 variants with lipid profiles and metabolic disorders

    • Relationship between FADS1 expression and fatty liver disease

    • Potential for personalized nutritional interventions

  • Therapeutic Implications:

    • Targeting the FADS1-PPARα-FGF21 axis

    • Dietary LC-PUFA supplementation to bypass reduced FADS1 function

    • PPARα agonists or FGF21 analogs as potential treatments

  • Biomarker Development:

    • Use of specific fatty acid ratios as indicators of FADS1 activity

    • Application in risk stratification and treatment monitoring

    • Integration with other metabolic markers

Research has shown that FADS1 genetic variants affect hepatic lipid composition in humans, with implications for fatty liver disease risk. These findings suggest potential for targeted interventions based on FADS1 genotype or function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.