Recombinant Papio anubis Insulin-induced gene 2 protein (INSIG2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized using heterologous expression systems:

  • Expression Host: Primarily E. coli , though mammalian cell systems are also documented .

  • Purification Method: Affinity chromatography via His-tag, followed by size-exclusion chromatography .

  • Purity: ≥85%–90% (verified by SDS-PAGE) .

  • Formulation: Lyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

Biochemical and Functional Roles

INSIG2 regulates cholesterol homeostasis through two mechanisms :

  1. SCAP-SREBP Retention: Binds oxysterols (e.g., 25-hydroxycholesterol) and anchors the SCAP-SREBP complex in the ER, preventing SREBP cleavage and nuclear translocation.

  2. HMGCR Degradation: Recruits HMG-CoA reductase (HMGCR) to the E3 ligase RNF139 for sterol-dependent ER-associated degradation (ERAD).

Key Functional Comparisons: INSIG1 vs. INSIG2

FeatureINSIG1INSIG2
Expression RegulationSREBP-dependent (inducible)Constitutive
Sterol SensitivityHigh-affinity sterol bindingLower affinity, broader sterol regulation
Tissue DistributionLiver, adiposeUbiquitous, including brain and muscle

Research Applications

  • Mechanistic Studies: Used to dissect sterol-sensing pathways and ERAD mechanisms .

  • Drug Development: Screens for compounds modulating cholesterol synthesis (e.g., statin alternatives) .

  • Structural Biology: Crystallization trials to resolve INSIG2-SCAP interaction sites .

Recent Findings

  • Transcriptional Regulation: The human INSIG2 promoter contains Ets-binding elements critical for basal expression, with ELK1 and SAP1a transcription factors implicated .

  • Phosphorylation Effects: PCK1-mediated phosphorylation reduces INSIG2’s oxysterol-binding capacity, linking glucose metabolism to cholesterol synthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
INSIG2; Insulin-induced gene 2 protein; INSIG-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Papio anubis (Olive baboon)
Target Names
INSIG2
Target Protein Sequence
MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP DVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH ASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATLVTQLLVYNGVYQY TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE
Uniprot No.

Target Background

Function
INSIG2 is an oxysterol-binding protein that plays a crucial role in regulating cholesterol synthesis through feedback control. It mediates both the endoplasmic reticulum (ER) to Golgi transport of SCAP and the degradation of HMGCR, effectively acting as a negative regulator of cholesterol biosynthesis. By retaining the SCAP-SREBP complex in the ER, INSIG2 blocks the processing of sterol regulatory element-binding proteins (SREBPs) SREBF1/SREBP1 and SREBF2/SREBP2. Its binding affinity for various oxysterols, including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol, and 27-hydroxycholesterol, modulates its interaction with SCAP and subsequent retention of the SCAP-SREBP complex in the ER. In the presence of oxysterols, INSIG2 interacts with SCAP, preventing SCAP from escorting SREBF1/SREBP1 and SREBF2/SREBP2 to the Golgi apparatus. This retention prevents the processing and nuclear translocation of SREBF1/SREBP1 and SREBF2/SREBP2, ultimately reducing cholesterol biosynthesis. When sterol deprivation or phosphorylation by PCK1 occurs, oxysterol-binding is reduced, disrupting the interaction between INSIG2 and SCAP. This disruption promotes Golgi transport of the SCAP-SREBP complex, leading to processing and nuclear translocation of SREBF1/SREBP1 and SREBF2/SREBP2. Beyond its role in SCAP-mediated cholesterol regulation, INSIG2 also regulates cholesterol synthesis by influencing the degradation of HMGCR. It initiates the sterol-mediated ubiquitin-mediated ER-associated degradation (ERAD) of HMGCR by recruiting the reductase to the ubiquitin ligase RNF139.
Database Links

UniGene: Pan.4453

Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is INSIG2 and why is Papio anubis INSIG2 significant for research?

INSIG2 (Insulin-induced gene 2 protein) is a membrane protein that regulates cholesterol and fatty acid synthesis by controlling the activation of sterol regulatory element-binding proteins (SREBPs). Papio anubis (Olive baboon) INSIG2 is significant for research because:

  • Baboons share approximately 94% genetic similarity with humans, making them valuable models for studying human metabolic disorders

  • Baboon models allow for translational research on metabolic syndrome, obesity, and insulin resistance

  • Papio anubis INSIG2 enables comparative studies of cholesterol metabolism regulation across primate species

  • Unlike murine models, baboon metabolic responses more closely resemble human physiological responses

The evolutionary conservation of INSIG2 across species highlights its fundamental importance in cellular metabolism, while species-specific variations may provide insights into metabolic adaptations.

How does recombinant Papio anubis INSIG2 differ structurally from human INSIG2?

Recombinant Papio anubis INSIG2 shares high sequence homology with human INSIG2, but contains specific amino acid differences that may affect protein-protein interactions and functional properties. While the core functional domains remain highly conserved, key differences include:

  • Subtle amino acid substitutions in transmembrane domains that may influence membrane topology

  • Minor variations in binding sites for interacting partners such as SCAP (SREBP cleavage-activating protein)

  • Potentially different post-translational modification patterns, particularly glycosylation sites

These structural differences, while subtle, could impact experimental outcomes when using baboon INSIG2 as a model for human metabolic pathways. Researchers should consider these variations when designing experiments and interpreting results, particularly in binding studies or when evaluating small molecule interactions.

What expression systems are most effective for producing recombinant Papio anubis INSIG2?

Based on comparative analysis with other recombinant primate proteins, the following expression systems have proven effective for Papio anubis INSIG2 production:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliRapid production, cost-effective, suitable for structural studiesLimited post-translational modifications, potential improper folding of membrane domains3-5 mg/L culture
Yeast (S. cerevisiae, P. pastoris)Better membrane protein folding, some post-translational modificationsLonger production time, more complex purification1-3 mg/L culture
Mammalian cells (HEK293, CHO)Native-like folding and post-translational modificationsHigher cost, lower yield, longer production time0.5-1 mg/L culture
Insect cells (Sf9, Sf21)Balance between yield and post-translational modificationsModerate cost, glycosylation patterns differ from mammalian1-2 mg/L culture

For functional studies where protein-protein interactions are critical, mammalian or insect cell expression systems are recommended despite lower yields. For structural studies requiring larger protein quantities, E. coli systems with optimization of membrane protein expression protocols may be suitable .

What are the optimal storage conditions for recombinant Papio anubis INSIG2?

Recombinant Papio anubis INSIG2 protein stability is maximized under the following storage conditions:

  • For long-term storage: Store lyophilized protein at -80°C or aliquot reconstituted protein and store at -20°C/-80°C

  • Reconstitution buffer: Tris/PBS-based buffer, pH 8.0 with 6% trehalose as a cryoprotectant

  • Recommended protein concentration: 0.1-1.0 mg/mL after reconstitution

  • Addition of 5-50% glycerol as a stabilizing agent for the final formulation

  • Avoid repeated freeze-thaw cycles as they significantly decrease protein activity

Working aliquots can be stored at 4°C for up to one week, but long-term storage requires freezing. The addition of reducing agents (e.g., DTT or β-mercaptoethanol at 1-5 mM) may help prevent oxidation of cysteine residues for certain applications .

How does the promoter region of Papio anubis INSIG2 compare to the human INSIG2 promoter?

The INSIG2 promoter region shows significant conservation between humans and non-human primates, including Papio anubis. Based on comparative genomics and the characterization of the human INSIG2 promoter:

  • The proximal promoter region (approximately 350 bp upstream of the transcription start site) likely contains essential regulatory elements in both species

  • Critical Ets binding elements that have been identified in the human INSIG2 promoter are likely conserved in Papio anubis

  • The human INSIG2 gene produces transcript variants (particularly the 2a and 2b isoforms), and similar variants may exist in Papio anubis

  • Both species likely share conserved binding sites for transcription factors such as ELK1 and SAP1a that regulate INSIG2 expression

In humans, the first 150 bp upstream of the transcription start site retains approximately 40% of the promoter activity, suggesting this region contains a basal promoter critical for gene expression. Similar regulatory mechanisms likely exist in Papio anubis INSIG2, though species-specific variations in transcription factor binding affinity may result in differential expression patterns .

What experimental approaches are most effective for studying INSIG2-SREBP interactions in Papio anubis models?

Studying INSIG2-SREBP interactions in Papio anubis models requires specialized approaches:

  • Co-immunoprecipitation (Co-IP) assays:

    • Use anti-His tag antibodies for tagged recombinant Papio anubis INSIG2

    • Cross-validate with species-specific INSIG2 antibodies if available

    • Western blot detection of co-precipitated SREBP and SCAP proteins

  • FRET/BRET protein interaction assays:

    • Generate fluorescent/bioluminescent fusion proteins

    • Express in primate cell lines for native-like membrane environments

    • Measure energy transfer as indicator of protein proximity

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified recombinant INSIG2 on sensor chips

    • Measure binding kinetics with SREBP regulatory domain

    • Compare with human protein interactions for translational relevance

  • Lipidomic analysis:

    • Monitor changes in cellular cholesterol and oxysterol levels

    • Correlate with INSIG2-SREBP complex formation

    • Use LC-MS/MS for comprehensive sterol profiling

The biological activity of recombinant Papio anubis INSIG2 should be validated using functional ELISA assays that assess binding capabilities, similar to approaches used for other recombinant proteins from this species .

How do age-related changes in Papio anubis affect INSIG2 expression and function?

Age-related changes in Papio anubis metabolism may significantly impact INSIG2 expression and function based on studies of age-associated alterations in olive baboons:

  • Aging baboons demonstrate altered inflammatory cytokine profiles that may indirectly influence INSIG2 regulation

  • Changes in metabolic parameters with age (insulin sensitivity, lipid profiles) correlate with altered INSIG2 function

  • Age-dependent shifts in cholesterol metabolism may be reflected in differential INSIG2 expression patterns

  • Older baboons show increased markers of oxidative stress, which may affect INSIG2-mediated regulation of lipid metabolism

Research methodologies to investigate these age-related changes include:

  • Age-stratified qPCR analysis of INSIG2 expression in hepatic and adipose tissues

  • Correlation of INSIG2 levels with inflammatory markers like IL-6, TNF-α, and IL-1β

  • Chromatin immunoprecipitation assays to assess age-related changes in transcription factor binding to the INSIG2 promoter

  • Functional assays comparing INSIG2-mediated cholesterol regulation in young versus aged baboons

These investigations are particularly relevant as Papio anubis serves as an excellent model for age-related metabolic disorders in humans .

What are the challenges in generating INSIG2 knockout or knockdown models in Papio anubis?

Generating INSIG2 knockout or knockdown models in Papio anubis presents several technical and biological challenges:

  • Technical challenges:

    • Limited genetic manipulation tools optimized for baboon cells

    • Lower transfection/transduction efficiency compared to rodent models

    • Longer generation time and higher maintenance costs for in vivo models

    • Need for specialized primate research facilities

  • Biological considerations:

    • INSIG2 is essential for lipid homeostasis, and complete knockout may be lethal

    • Compensation by INSIG1 may mask phenotypes in partial knockdown models

    • Complex regulation of INSIG2 through multiple promoters and splice variants

    • Species-specific differences in INSIG2 regulatory networks

  • Methodological approaches:

    • CRISPR/Cas9 system optimized for primate cells with baboon-specific guide RNAs

    • Inducible knockdown systems (tetracycline-controlled) to avoid developmental lethality

    • Tissue-specific knockout approaches targeting liver or adipose tissue

    • Ex vivo culture systems using primary baboon hepatocytes with siRNA knockdown

The development of such models, despite challenges, would provide valuable insights into metabolic regulation that may be more directly translatable to human physiology than existing rodent models.

What purification strategy yields the highest purity recombinant Papio anubis INSIG2?

A multi-step purification strategy is recommended for obtaining high-purity recombinant Papio anubis INSIG2:

Purification StepDescriptionExpected PurityYield Recovery
Affinity ChromatographyNi-NTA for His-tagged protein70-80%80-90%
Detergent SelectionUse of mild detergents (DDM, LMNG) for membrane proteinMaintains structure70-80%
Size Exclusion ChromatographySeparates aggregates and improves homogeneity85-90%70-75%
Ion Exchange ChromatographyOptional polishing step>95%60-70%

Critical considerations for INSIG2 purification include:

  • Membrane protein nature requires proper detergent selection throughout purification

  • Addition of cholesterol or oxysterols may stabilize protein conformation

  • Temperature sensitivity requires purification at 4°C

  • Reducing agents should be maintained to prevent disulfide-mediated aggregation

Final purity can be assessed by SDS-PAGE (>90% purity) and analytical SEC-MALS to confirm monodispersity .

How can researchers verify the functional activity of recombinant Papio anubis INSIG2?

Functional verification of recombinant Papio anubis INSIG2 should include multiple complementary approaches:

  • Binding assays:

    • ELISA-based assays measuring interaction with known partners (SCAP, sterols)

    • Fluorescence-based sterol binding assays using NBD-cholesterol

    • Surface plasmon resonance to determine binding kinetics

  • Cell-based functional assays:

    • Transfection of recombinant INSIG2 into INSIG-deficient cells

    • Measurement of SREBP processing via reporter assays

    • Quantification of cholesterol synthesis rates

    • Analysis of lipogenic gene expression (HMGCR, FASN)

  • Structural integrity verification:

    • Circular dichroism to confirm proper secondary structure

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to verify proper folding

  • Comparative analysis:

    • Side-by-side comparison with human INSIG2 in functional assays

    • Dose-response curves with known INSIG2 modulators

The biological activity determination should follow approaches similar to those used for other recombinant Papio anubis proteins, such as binding ability assessment in a functional ELISA .

What analytical methods are most accurate for determining the post-translational modifications of Papio anubis INSIG2?

Post-translational modifications (PTMs) of Papio anubis INSIG2 can be accurately characterized using the following analytical methods:

  • Mass Spectrometry-Based Approaches:

    • Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS) for comprehensive PTM mapping

    • Electron Transfer Dissociation (ETD) for improved analysis of glycosylation sites

    • MALDI-TOF MS for intact protein mass and modification profiling

    • Targeted Multiple Reaction Monitoring (MRM) for quantitative PTM analysis

  • Site-Specific Analysis:

    • Enzymatic deglycosylation (PNGase F, Endo H) followed by mobility shift analysis

    • Phospho-specific antibody detection for phosphorylation sites

    • Chemical labeling strategies for specific PTM enrichment

  • Structural Impact Assessment:

    • Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS) to evaluate PTM effects on protein dynamics

    • Cross-linking Mass Spectrometry (XL-MS) to identify PTM-induced conformational changes

The expected post-translational modifications for INSIG2 include:

  • N-linked glycosylation at conserved asparagine residues

  • Phosphorylation at regulatory serine/threonine sites

  • Potential palmitoylation important for membrane localization

These analyses are crucial as PTMs significantly impact INSIG2 function, stability, and protein-protein interactions in lipid regulatory pathways.

What considerations are important when designing antibodies against Papio anubis INSIG2?

Designing effective antibodies against Papio anubis INSIG2 requires careful consideration of multiple factors:

  • Epitope Selection Strategy:

    • Target extracellular or cytoplasmic domains rather than transmembrane regions

    • Identify regions with high antigenicity but sufficient species-specificity

    • Consider using peptide arrays to identify optimal epitopes

    • Evaluate conservation with human INSIG2 if cross-reactivity is desired

  • Species Cross-Reactivity Assessment:

    • Sequence alignment between Papio anubis, human, and other primate INSIG2

    • Identification of unique vs. conserved epitopes

    • Validation in multiple primate species if broad reactivity is needed

  • Antibody Format Selection:

    • Monoclonal antibodies for high specificity applications

    • Polyclonal antibodies for multiple epitope recognition

    • Recombinant antibody fragments (Fab, scFv) for special applications

  • Validation Requirements:

    • Western blot against recombinant protein and native extracts

    • Immunoprecipitation efficiency testing

    • Immunofluorescence to confirm expected cellular localization

    • Knockout/knockdown controls to confirm specificity

A well-designed antibody should be validated in multiple applications and tested for specificity against related proteins, particularly INSIG1, which shares structural similarities with INSIG2.

How does Papio anubis INSIG2 function compare to INSIG2 in other primate models?

Comparative analysis of INSIG2 function across primate models reveals important evolutionary insights:

Primate SpeciesINSIG2 Sequence Similarity to HumanKey Functional DifferencesResearch Application
Papio anubis (Olive baboon)~95-97%Minor differences in sterol sensitivityMetabolic disease modeling
Pongo abelii (Orangutan)~97-98%Similar regulatory mechanismEvolutionary studies
Macaca mulatta (Rhesus macaque)~96-97%Comparable SREBP regulationDrug development
Pan troglodytes (Chimpanzee)~99%Nearly identical functionTranslational research

The high conservation of INSIG2 across primates reflects its essential role in cholesterol homeostasis, but subtle species-specific differences may influence:

  • Sensitivity to regulatory sterols and oxysterols

  • Interaction affinity with SCAP and SREBP proteins

  • Response to pharmaceutical modulators of cholesterol metabolism

  • Tissue-specific expression patterns

These comparative studies help identify conserved functional domains versus species-specific adaptations, providing insights into the evolution of metabolic regulation in primates .

What insights can Papio anubis INSIG2 provide about metabolic disorders relevant to humans?

Papio anubis INSIG2 research offers valuable insights into human metabolic disorders due to several factors:

  • Baboons naturally develop metabolic syndrome and diabetes with age, similar to humans

  • Baboon lipid metabolism more closely resembles human patterns than rodent models

  • INSIG2 polymorphisms have been associated with obesity in humans, and similar associations can be studied in baboons

  • The regulatory network of INSIG2 in cholesterol homeostasis is highly conserved between species

Key research applications include:

  • Obesity and insulin resistance studies:

    • Correlation between INSIG2 expression/function and adiposity measures

    • Impact of INSIG2 variants on diet-induced obesity susceptibility

    • Role in hepatic insulin resistance development

  • Non-alcoholic fatty liver disease (NAFLD) research:

    • INSIG2 function in preventing hepatic steatosis

    • Interaction with dietary factors in NAFLD progression

    • Therapeutic targeting potential in liver-specific metabolic disorders

  • Pharmacological studies:

    • Screening of INSIG2 modulators with translational potential

    • Comparative drug responses between baboon and human INSIG2

    • Development of metabolism-targeting therapeutics

The baboon model provides a unique opportunity to study INSIG2 in the context of naturally occurring metabolic disorders rather than artificially induced conditions often used in rodent models .

How does the binding affinity of Papio anubis INSIG2 to regulatory sterols compare with human INSIG2?

The binding affinity of Papio anubis INSIG2 to regulatory sterols such as 25-hydroxycholesterol and other oxysterols shows subtle but potentially significant differences compared to human INSIG2:

  • Sterol Binding Profile:

    • Both proteins bind 25-hydroxycholesterol with high affinity

    • Subtle differences in binding pocket architecture may affect affinity to certain oxysterols

    • Cholesterol binding likely occurs through a similar mechanism in both species

    • Differences in binding kinetics (association/dissociation rates) may exist

  • Structural Basis for Differences:

    • Minor amino acid substitutions in the sterol-sensing domain

    • Potentially different conformational dynamics upon sterol binding

    • Conservation analysis reveals highly preserved sterol interaction residues

  • Methodological Approaches for Comparison:

    • Isothermal titration calorimetry (ITC) for direct affinity measurements

    • Surface plasmon resonance (SPR) for binding kinetics determination

    • Fluorescence-based binding assays with labeled sterols

    • Computational modeling and molecular dynamics simulations

  • Functional Implications:

    • Differences in sterol affinity may translate to species-specific thresholds for SREBP regulation

    • Pharmacological modulators may exhibit species-specific potency

    • Dietary sterol response may vary between humans and baboons

These comparative binding studies provide crucial information for translating findings between baboon models and human applications in metabolic research.

What are the key considerations when using Papio anubis INSIG2 as a surrogate for human INSIG2 in drug discovery?

When utilizing Papio anubis INSIG2 as a surrogate for human INSIG2 in drug discovery efforts, researchers should consider these critical factors:

  • Sequence and Structural Considerations:

    • Identify and account for amino acid differences in drug-binding regions

    • Evaluate conservation of allosteric regulatory sites

    • Consider potential differences in post-translational modifications affecting drug binding

    • Assess protein dynamics and conformational states using HDX-MS or computational modeling

  • Functional Equivalence Validation:

    • Establish comparable dose-response relationships for known modulators

    • Verify similar interaction profiles with partner proteins (SCAP, SREBP)

    • Confirm equivalent cellular localization and trafficking patterns

    • Validate similar responses to cellular cholesterol depletion/loading

  • Experimental Design Recommendations:

    • Include human INSIG2 controls in parallel assays

    • Develop species-specific cellular assays with matched expression levels

    • Consider dual-species testing in early discovery phases

    • Validate hits with orthogonal assays across species

  • Translational Considerations:

    • Establish in vitro-in vivo correlation in baboon models before human translation

    • Account for potential species differences in metabolism of drug candidates

    • Consider differences in tissue distribution and expression levels between species

    • Address species-specific regulatory networks that may influence drug effects

By carefully addressing these considerations, researchers can maximize the translational value of Papio anubis models in INSIG2-targeted drug discovery while minimizing late-stage failures due to species differences.

How might genomic editing technologies be optimized for studying INSIG2 function in Papio anubis models?

Genomic editing technologies for studying INSIG2 in Papio anubis can be optimized through several innovative approaches:

  • CRISPR/Cas9 Optimization:

    • Development of baboon-specific guide RNA design algorithms

    • Evaluation of alternative Cas9 variants for improved specificity in primate cells

    • Optimization of delivery methods for primary baboon cells and tissues

    • Development of inducible/conditional CRISPR systems for temporal control

  • HDR Enhancement Strategies:

    • Optimization of homology-directed repair templates for baboon cells

    • Evaluation of HDR enhancers such as RAD51 stimulators

    • Synchronization protocols to maximize editing in specific cell cycle phases

    • Implementation of base editing or prime editing technologies

  • In Vivo Editing Approaches:

    • AAV-based delivery systems optimized for primate liver targeting

    • Ex vivo editing of baboon hepatocytes followed by transplantation

    • Lipid nanoparticle formulations for tissue-specific delivery

    • Embryonic manipulation for germline editing under strict ethical oversight

  • Validation and Phenotyping Methodologies:

    • Development of baboon-specific antibodies and assays for INSIG2

    • Multi-omics approaches to characterize edited models

    • Non-invasive metabolic monitoring technologies

    • Standardized phenotyping protocols for metabolic parameters

These optimized technologies would enable precise manipulation of INSIG2 in baboon models, allowing for mechanistic studies of metabolic regulation that more accurately reflect human physiology than current rodent models.

What role might Papio anubis INSIG2 play in aging-related metabolic dysfunction research?

Papio anubis INSIG2 offers unique opportunities for studying aging-related metabolic dysfunction:

  • Age-Associated INSIG2 Alterations:

    • Changes in expression levels across the baboon lifespan

    • Age-dependent post-translational modifications affecting function

    • Altered cellular localization and trafficking in aged tissues

    • Modifications in sterol sensitivity with advancing age

  • Metabolic Impact Assessment:

    • Correlation between INSIG2 function and age-related insulin resistance

    • Role in age-associated hepatic lipid accumulation

    • Influence on adipose tissue distribution changes with age

    • Interaction with age-related inflammatory pathways

  • Research Methodologies:

    • Longitudinal studies tracking INSIG2 function across baboon lifespan

    • Tissue-specific analysis from young, middle-aged, and elderly baboons

    • Correlation with comprehensive metabolic and inflammatory markers

    • Comparison with age-matched human samples for translational relevance

The natural aging process in baboons closely mimics human metabolic aging, making INSIG2 research in this model particularly valuable for understanding age-related disorders such as type 2 diabetes, NAFLD, and cardiovascular disease with potential therapeutic implications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.