Recombinant Papio anubis Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Papio anubis Melanocyte-Stimulating Hormone Receptor (MC1R)

The Recombinant Papio anubis Melanocyte-Stimulating Hormone Receptor (MC1R) is a genetically engineered form of the MC1R protein derived from the olive baboon (Papio anubis), a primate species native to Africa. MC1R is a G-protein coupled receptor (GPCR) critical for regulating melanogenesis, UV response, and skin pigmentation through cAMP signaling . Recombinant MC1R enables functional studies of receptor-ligand interactions, structural analysis, and pharmacological testing in vitro.

Molecular Architecture

  • Domain Organization: MC1R consists of seven transmembrane α-helical domains (TMs), an extracellular N-terminal domain, and an intracellular C-terminal tail . Key structural features include:

    • A conserved DRY motif at the third TM domain for G-protein coupling .

    • A cysteine-rich N-terminus critical for ligand binding and receptor dimerization .

    • A short C-terminal tail (14 amino acids) involved in trafficking and signaling .

  • Key Residues: Species-specific substitutions in MC1R (e.g., Y267C in Macaca hecki) alter basal cAMP activity and ligand responsiveness .

Functional Properties

  • Ligand Interactions:

    LigandEffect on MC1ROutcome
    α-MSH (agonist)↑ cAMP production via adenylyl cyclase activationEumelanin synthesis
    ASIP (antagonist)↓ cAMP productionPheomelanin synthesis
    β-defensin 3Neutral antagonistModulates UV-induced DNA repair
  • Basal Activity: MC1R exhibits constitutive ligand-independent signaling, as demonstrated in murine models .

Expression Systems

Recombinant MC1R is typically expressed in E. coli or mammalian cell lines (e.g., HEK293) for functional assays. For example:

  • E. coli Expression: Used for producing full-length MC1R with N-terminal His tags, yielding ≥90% purity (as validated by SDS-PAGE) .

  • Mammalian Systems: Enable post-translational modifications critical for ligand binding and signaling .

Applications in Research

  • Pigmentation Studies: MC1R variants (e.g., P153H in Macaca maurus) show reduced cAMP production, linking polymorphisms to coat color diversity .

  • Pharmacological Screening: Used to test agonist/antagonist efficacy (e.g., EC₅₀ values for α-MSH binding) .

  • Gene Editing: CRISPR-mediated MC1R edits in pigs altered coat color phenotypes, demonstrating functional conservation across species .

Genomic Features

The Papio anubis genome (Panubis1.0 assembly) reveals high synteny with human and macaque genomes, facilitating MC1R homology studies . Key findings:

  • Contiguity: Single scaffolds span all autosomes (N50 = 140 Mb), enhancing gene annotation accuracy .

  • Polymorphisms: Non-coding SNPs in MC1R regulatory regions may influence expression levels .

Functional Implications

While recombinant Papio anubis MC1R has not been explicitly characterized, studies on related primates suggest:

  • Conserved Signaling: MC1R in Papio anubis likely shares cAMP-dependent melanogenic pathways with humans .

  • Mutation Effects: Analogous to dromedaries, substitutions in transmembrane domains (e.g., Arg301Cys) could disrupt receptor function .

Challenges and Future Directions

  • Expression Optimization: Low yields in bacterial systems necessitate codon optimization or eukaryotic expression .

  • Structural Studies: Cryo-EM or X-ray crystallography of recombinant MC1R could resolve ligand-binding mechanisms .

  • In Vivo Models: CRISPR-edited Papio anubis models could validate MC1R's role in UV protection and melanoma risk .

Table 1: MC1R Functional Metrics Across Species

SpeciesBasal cAMP Activityα-MSH EC₅₀ (nM)Key Mutations
Papio anubis (predicted)Moderate~1.0*Undocumented
Macaca nemestrinaHigh0.316 ± 0.180Y267C (gain-of-function)
HumanLow0.5–2.0R151C (loss-of-function)

*Inferred from macaque data .

Table 2: Recombinant MC1R Production Parameters

ParameterDetails
Host SystemE. coli (e.g., BL21)
TagN-terminal His tag
Purity≥90% (SDS-PAGE)
Storage-80°C in Tris/PBS + 6% trehalose

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Papio anubis (Olive baboon)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEVSVPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGVLAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLFSTLFI AYYDHAAVLLCLVIFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRLAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor binds to MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. It mediates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), through the regulation of cAMP signaling in melanocytes.
Database Links

UniGene: Pan.17939

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MC1R in Papio anubis pigmentation?

In Papio anubis (olive baboons), as in other primates, MC1R functions as a G-protein coupled receptor primarily expressed on melanocytes where it regulates pigmentation. MC1R activation triggers the adenylate cyclase pathway, generating cAMP as a secondary messenger that initiates a signaling cascade leading to eumelanin (dark pigment) production. When MC1R signaling is inhibited or altered, melanocytes produce more pheomelanin (red-yellow pigment) instead . In olive baboons, MC1R exhibits species-specific characteristics that contribute to their distinctive coat coloration patterns, although they maintain the fundamental signaling mechanisms seen across primates.

How does α-MSH interact with Papio anubis MC1R?

Alpha-melanocyte stimulating hormone (α-MSH) functions as an agonist for MC1R in Papio anubis, binding to the receptor and activating the cAMP signaling pathway. Upon binding, α-MSH triggers a dose-dependent response in cAMP production, similar to what has been observed in other macaque species . Research shows that olive baboon MC1R demonstrates a measurable sensitivity to α-MSH comparable to other primates, with EC50 values that reflect the receptor's binding affinity. The resulting activation leads to increased intracellular cAMP levels that ultimately promote eumelanin synthesis through downstream transcriptional activation of pigmentation enzymes including tyrosinase, TRP1, and TRP2 .

What methods are used to study MC1R function in baboons?

Researchers employ several techniques to study MC1R function in baboons, including:

  • cAMP assays: Measuring basal and α-MSH-induced cAMP levels to determine receptor activity and signaling capabilities .

  • Immunofluorescence studies: Analyzing cellular localization and trafficking of MC1R within melanocytes .

  • Ligand binding assays: Quantifying the binding affinity of agonists (α-MSH) and antagonists (agouti signaling protein) to the receptor .

  • Behavioral discrimination tasks: Using controlled experiments to assess how pigmentation differences might influence visual perception in baboons .

These methods allow researchers to characterize both the molecular and functional aspects of MC1R in Papio anubis, providing insights into the receptor's role in pigmentation regulation.

How do specific amino acid substitutions affect MC1R function in olive baboons?

Specific amino acid substitutions in MC1R can dramatically alter receptor function through various mechanisms. While the search results don't specifically detail olive baboon MC1R mutations, studies in related species provide valuable insights. In Sulawesi macaques, fixed species-specific amino acid substitutions resulted in measurable differences in both basal activity and agonist-induced responses .

Key substitutions can affect:

  • Basal activity: Certain mutations (such as G304E in M. nigra or S104G in M. tonkeana) significantly increase constitutive activity without ligand binding .

  • Agonist sensitivity: Substitutions like Y267C in M. hecki MC1R rescue binding affinity to α-MSH, shifting the dose-response curve leftward and enhancing cAMP production .

  • Receptor trafficking: Some variants (such as P153H in M. maurus) reduce basal cAMP production and shift the dose-response curve rightward .

For recombinant Papio anubis MC1R, researchers would need to conduct site-directed mutagenesis experiments to precisely identify which amino acid positions are critical for function and cellular localization.

How does UV radiation influence MC1R expression and function in Papio anubis melanocytes?

UV radiation significantly impacts MC1R expression and function, representing a critical environmental factor in pigmentation regulation. Experimental data shows that melanocytes exposed to UV radiation (75 or 105 mJ/cm²) undergo alterations in MC1R expression as measured by qRT-PCR . This response is part of the skin's protective mechanism against UV-induced damage.

UV radiation likely influences Papio anubis MC1R through multiple mechanisms:

  • Transcriptional regulation: UV exposure can increase MC1R mRNA expression, enhancing cellular capacity to respond to α-MSH.

  • DNA damage response: UV-induced DNA damage activates p53, which may upregulate both MC1R and POMC (the precursor to α-MSH).

  • Inflammatory response: UV radiation triggers cytokine release, which can modulate MC1R expression and function.

  • Receptor sensitivity: UV exposure may alter MC1R sensitivity to its ligands through post-translational modifications.

These UV-induced changes in MC1R expression and function ultimately lead to increased eumelanin production, which provides photoprotection against further UV damage.

What are the implications of MC1R polymorphisms for adaptive pigmentation in non-human primates?

MC1R polymorphisms play crucial roles in adaptive pigmentation across non-human primates, with significant evolutionary implications. Studies of macaques inhabiting Sulawesi Island demonstrate that fixed species-specific MC1R variants correspond with divergent receptor activity patterns . These functional differences likely contribute to the varied coat colors observed among closely related species.

The adaptive significance includes:

  • Environmental adaptation: Different pigmentation patterns may provide advantages in specific habitats (camouflage, thermoregulation).

  • Species recognition: Distinctive coat colors can facilitate mate recognition and reproductive isolation.

  • UV protection: Darker pigmentation in regions with higher UV radiation offers enhanced photoprotection.

  • Social signaling: Pigmentation patterns may serve as signals in social hierarchies and mating contexts.

In Sulawesi macaques, which diverged rapidly from their common ancestor (M. nemestrina), MC1R sequences show fixed non-synonymous substitutions in each species, correlating with variation in both constitutive and agonist-induced activity . This pattern suggests that selection on MC1R function has contributed to pigmentary diversification across closely related species.

How does the cAMP signaling cascade differ between wild-type and variant MC1R in primates?

The cAMP signaling cascade shows significant differences between wild-type and variant MC1R in primates, affecting downstream pigmentation outcomes. Based on functional studies of macaque MC1R variants, these differences manifest in several ways:

MC1R Variant TypeBasal cAMP Activityα-MSH Response (EC50)Maximal cAMP Production
Wild-type (e.g., M. nemestrina)High0.709 ± 0.363 nMHigh (reference)
M. maurus variantHigh0.663 ± 0.339 nMSimilar to wild-type
M. nigrescens variantReduced0.968 ± 0.490 nMReduced
M. ochreata variantReduced1.125 ± 0.477 nMReduced
M. nigra variantMarkedly reduced1.458 ± 0.803 nMSignificantly lower
M. tonkeana variantReduced1.886 ± 0.583 nMReduced
M. hecki variantMarkedly reducedNot determined*Reduced

*Saturation not reached with 100 nM α-MSH stimulation

These differences in cAMP signaling ultimately translate to altered melanogenesis pathways, with reduced MC1R signaling generally favoring pheomelanin production over eumelanin. For Papio anubis, similar variations in MC1R would be expected to produce comparable effects on downstream signaling pathways.

What are the optimal conditions for expressing recombinant Papio anubis MC1R in heterologous systems?

Expressing recombinant Papio anubis MC1R in heterologous systems requires careful optimization of several parameters:

Expression System Selection:

  • Mammalian cell lines: HEK293 or COS-7 cells are preferred for maintaining proper post-translational modifications and trafficking of primate MC1R.

  • Melanocytic cell lines: For studies requiring the complete melanogenic machinery, melanocyte-derived cell lines provide a more physiologically relevant background.

Vector Design Considerations:

  • Include a strong promoter (CMV or EF1α) to drive adequate expression

  • Incorporate an epitope tag (FLAG, HA, or His) for detection and purification

  • Consider codon optimization for improved expression in the chosen host system

Transfection Protocol:

  • Lipid-based transfection (Lipofectamine) typically yields 30-60% transfection efficiency for MC1R

  • Nucleofection may provide improved efficiency for difficult-to-transfect cell types

  • Allow 48-72 hours post-transfection for optimal receptor expression before functional assays

Culture Conditions:

  • Maintain cells at 37°C with 5% CO2

  • For temperature-sensitive variants, culturing at 30°C may improve cell surface expression

  • Include appropriate selection markers for stable cell line generation

These conditions have been effectively used for studying MC1R variants in related species and would be applicable to recombinant Papio anubis MC1R expression .

How can researchers design effective cAMP assays to evaluate MC1R function in Papio anubis?

Designing effective cAMP assays for evaluating Papio anubis MC1R function requires attention to several methodological details:

Assay Selection:

  • ELISA-based cAMP assays: Provide quantitative measurement of total cAMP levels

  • FRET-based sensors: Allow real-time monitoring of cAMP dynamics

  • Luciferase reporter systems: Measure downstream cAMP-responsive element (CRE) activation

Experimental Protocol:

  • Seed cells expressing recombinant MC1R in appropriate multi-well plates

  • Serum-starve cells (4-6 hours) to reduce background signaling

  • Treat with phosphodiesterase inhibitors (e.g., IBMX, 500 μM) to prevent cAMP degradation

  • Apply α-MSH in a concentration range of 0.1 nM to 1000 nM for dose-response curves

  • Include forskolin (1 μM) as a positive control that directly activates adenylate cyclase

  • Include antagonist controls (ASIP or HBD3, 100 nM) to confirm specificity

  • Incubate for optimal duration (typically 15-30 minutes for acute responses)

  • Measure cAMP levels according to the specific assay protocol

Data Analysis:

  • Calculate EC50 values to determine receptor sensitivity to agonist

  • Compare basal activity (without agonist) to assess constitutive activity

  • Normalize data to maximum response or protein content for cross-experiment comparison

  • Use appropriate statistical tests (t-test with Benjamini-Hochberg correction for multiple comparisons)

This approach has been successfully used to characterize MC1R function in macaques and would be directly applicable to Papio anubis MC1R studies .

What methods can be used to study MC1R cell surface expression in olive baboon melanocytes?

Multiple complementary techniques can be employed to study MC1R cell surface expression in olive baboon melanocytes:

Immunofluorescence Microscopy:

  • Fix cells with 4% paraformaldehyde without permeabilization to visualize only surface receptors

  • Use antibodies against extracellular epitopes or epitope tags inserted in extracellular loops

  • Compare with permeabilized samples to assess total versus surface expression

  • Analyze using confocal microscopy for precise localization

Cell Surface Biotinylation:

  • Label surface proteins with membrane-impermeable biotin reagents

  • Isolate biotinylated proteins using streptavidin pull-down

  • Detect MC1R by Western blotting

  • Quantify surface/total ratios to assess trafficking efficiency

Flow Cytometry:

  • Label non-permeabilized cells with fluorescently-tagged antibodies against MC1R

  • Analyze fluorescence intensity as a measure of surface expression

  • Compare wild-type and variant receptors in parallel experiments

  • Use mean fluorescence intensity to quantify surface levels

Radioligand Binding Assays:

  • Incubate intact cells with radiolabeled ligands (e.g., 125I-NDP-MSH)

  • Measure specific binding as an indicator of functional surface receptors

  • Determine Bmax values to quantify receptor density

  • Calculate Kd values to assess binding affinity

Studies of human MC1R variants have demonstrated that certain mutations significantly reduce cell surface expression, and similar approaches would be valuable for characterizing Papio anubis MC1R variants .

How can site-directed mutagenesis be used to identify critical residues in Papio anubis MC1R?

Site-directed mutagenesis represents a powerful approach for identifying critical functional residues in Papio anubis MC1R:

Mutagenesis Strategy:

  • Targeted approach: Focus on evolutionarily conserved residues or those that differ from closely related species

  • Systematic scanning: Create alanine substitutions across transmembrane domains or ligand-binding regions

  • Reciprocal mutations: Exchange amino acids between baboon and human/macaque MC1R to identify species-specific determinants

  • Structure-guided design: Target residues predicted to participate in G-protein coupling or ligand binding

Technical Protocol:

  • Design mutagenic primers with 15-20 nucleotide flanking sequences around the target site

  • Use PCR-based mutagenesis (e.g., QuikChange) on a wild-type Papio anubis MC1R template

  • Transform bacteria and select colonies for plasmid isolation

  • Verify mutations by DNA sequencing before expression studies

  • Express wild-type and mutant receptors in parallel experiments

Functional Assessment:

  • Measure α-MSH-induced cAMP production to assess signaling capacity

  • Compare EC50 values to determine changes in agonist sensitivity

  • Assess basal activity to identify constitutively active or inactive mutants

  • Evaluate cell surface expression to distinguish between trafficking and signaling defects

This approach has been successfully applied to macaque MC1R variants, revealing that single amino acid substitutions (G304E in M. nigra, S104G in M. tonkeana, Y267C in M. hecki, and P153H in M. maurus) can significantly alter receptor function . Similar studies would be highly informative for Papio anubis MC1R.

How should researchers interpret changes in MC1R basal activity versus agonist-induced responses?

Interpreting changes in MC1R basal activity versus agonist-induced responses requires careful consideration of the distinct molecular mechanisms underlying each parameter:

Basal Activity Interpretation:

  • Enhanced basal activity may indicate constitutive activation due to mutations that mimic the active receptor conformation

  • Reduced basal activity could result from impaired G-protein coupling or receptor misfolding

  • Changes in basal activity directly impact melanocyte function even in the absence of ligand

Agonist-Induced Response Interpretation:

  • Altered EC50 values reflect changes in receptor affinity for α-MSH or efficiency of signal transduction

  • Reduced maximal response (efficacy) suggests impaired coupling to downstream effectors

  • Complete loss of response indicates critical mutations in ligand binding or signaling domains

Comparative Analysis Framework:

ParameterBiological SignificanceTechnical Considerations
Basal ActivityDetermines default melanin synthesisMeasure in serum-starved cells to minimize background
EC50Reflects receptor sensitivity to α-MSHCalculate from full dose-response curves (0.1-1000 nM α-MSH)
Maximal ResponseIndicates signaling capacityCompare to wild-type response and forskolin control
Response KineticsReveals regulatory mechanismsMonitor response over time (5-60 minutes)

In studies of macaque MC1R variants, researchers observed that different species exhibited distinct patterns of basal and agonist-induced activity. For example, M. maurus MC1R maintained high basal activity similar to the ancestral M. nemestrina MC1R, while other Sulawesi macaques showed markedly lower constitutive signaling . These functional differences likely contribute to species-specific pigmentation patterns and would be similarly informative for interpreting Papio anubis MC1R variants.

What statistical approaches are most appropriate for analyzing MC1R functional data?

Analyzing MC1R functional data requires robust statistical approaches to accurately interpret experimental results:

For Dose-Response Analysis:

  • Nonlinear regression using four-parameter logistic model to determine EC50 values and Hill coefficients

  • Extra sum-of-squares F-test to compare entire dose-response curves between variants

  • Confidence intervals for EC50 values to assess reliability of potency differences

For Comparing Multiple Variants:

  • One-way ANOVA followed by appropriate post-hoc tests (Tukey's or Dunnett's) for comparing multiple variants to wild-type

  • Benjamini-Hochberg correction for multiple comparisons to control false discovery rate

  • Two-way ANOVA to analyze interactions between receptor variants and experimental conditions

For Correlation Analysis:

  • Pearson's correlation to assess relationships between functional parameters (e.g., basal activity vs. coat color)

  • Linear regression to quantify relationships between molecular and phenotypic variables

  • Principal component analysis for complex datasets with multiple parameters

Sample Size Considerations:

  • Power analysis should be conducted to determine appropriate experimental replication

  • Typically, 3-6 independent experiments are needed for reliable MC1R functional characterization

  • Technical replicates (n=3-4) within each experiment improve measurement precision

In studies of macaque MC1R variants, statistical significance was established using pairwise t-tests with Benjamini-Hochberg adjustment, comparing both basal activity and agonist-induced responses across species . Similar robust statistical approaches would be essential for characterizing Papio anubis MC1R variants.

How can researchers distinguish between MC1R expression effects and functional differences?

Distinguishing between MC1R expression effects and intrinsic functional differences requires carefully designed experiments that separate these potentially confounding factors:

Approaches to Isolate Expression Effects:

  • Quantitative Western Blotting:

    • Measure total MC1R protein levels with antibodies against MC1R or epitope tags

    • Normalize to housekeeping proteins (β-actin, GAPDH)

    • Compare expression levels across variants to identify expression differences

  • Surface Expression Analysis:

    • Use cell surface biotinylation or flow cytometry to quantify surface receptor levels

    • Calculate surface/total ratios to assess trafficking efficiency

    • Identify variants with normal synthesis but impaired trafficking

  • Immunofluorescence Microscopy:

    • Visualize receptor localization in permeabilized and non-permeabilized cells

    • Identify intracellular retention patterns (ER, Golgi, endosomes)

    • Compare with markers for cellular compartments to pinpoint trafficking defects

Approaches to Normalize for Expression Differences:

  • Activity per Receptor:

    • Calculate cAMP production per unit of surface receptor

    • Use radioligand binding to quantify functional receptor density

    • This normalization reveals intrinsic signaling efficiency

  • Inducible Expression Systems:

    • Use tetracycline-regulated promoters to achieve equivalent expression

    • Titrate expression levels to match wild-type and variant receptors

    • Measure functional responses at matched expression levels

  • Single-Cell Analysis:

    • Correlate receptor expression and function in individual cells

    • Use FRET-based sensors for real-time cAMP measurement

    • This approach accounts for cell-to-cell expression variability

Human MC1R variant studies have demonstrated that certain mutations (R151C, R160W) significantly reduce cell surface expression while maintaining signaling capacity, while others (D294H) affect receptor function without altering trafficking . Similar combined approaches would be valuable for characterizing Papio anubis MC1R variants.

What approaches can be used to correlate MC1R function with pigmentation phenotypes in primates?

Correlating MC1R function with pigmentation phenotypes in primates requires integrative approaches that span molecular, cellular, and organismal levels:

Molecular-Phenotype Correlation Strategies:

  • Genotype-Phenotype Association:

    • Sequence MC1R in individuals with varied pigmentation

    • Quantify phenotypes using standardized color measurements or melanin content analysis

    • Perform association analysis between variants and quantitative traits

    • Calculate effect sizes for specific variants

  • Functional-Phenotype Correlation:

    • Measure functional parameters (basal activity, EC50, maximal response) for each variant

    • Plot functional data against phenotypic measures (melanin content, color values)

    • Perform regression analysis to quantify relationships

    • Test whether in vitro activity predicts in vivo pigmentation

  • Evolutionary Correlation:

    • Compare MC1R sequences across closely related species with different pigmentation

    • Identify fixed differences that correlate with species-specific color patterns

    • Test these variants in functional assays to validate their effects

    • Reconstruct ancestral sequences to understand evolutionary trajectories

Analytical Frameworks:

ApproachStrengthsLimitations
Quantitative geneticsEstablishes statistical associationMay miss functional mechanisms
In vitro functional studiesReveals molecular mechanismsMay not reflect in vivo complexity
Transgenic animal modelsTests causality directlyChallenging in non-model primates
Comparative genomicsIdentifies evolutionarily relevant changesCorrelation is not causation

In Sulawesi macaques, researchers found that species-specific MC1R variants corresponded with different functional characteristics that might contribute to divergence in coat color . The study combined sequence analysis, functional characterization, and correlation with phenotypic differences to establish meaningful connections between MC1R function and pigmentation. Similar integrative approaches would be valuable for understanding the role of MC1R in Papio anubis pigmentation.

How might new molecular techniques enhance our understanding of primate MC1R function?

Emerging molecular techniques offer powerful new approaches to understand primate MC1R function with unprecedented precision:

CRISPR/Cas9 Genome Editing:

  • Generate precise MC1R mutations in relevant cell types

  • Create isogenic cell lines differing only in MC1R sequence

  • Introduce Papio anubis MC1R variants into human melanocytes for comparative studies

  • Potentially develop non-human primate models with modified MC1R

Single-Cell Technologies:

  • Analyze MC1R expression and downstream pathways at single-cell resolution

  • Map heterogeneity in melanocyte responses within tissues

  • Correlate MC1R genotype with transcriptomic profiles in individual cells

  • Identify cell-specific factors that modulate MC1R function

Structural Biology Approaches:

  • Utilize cryo-electron microscopy to determine MC1R structure in different activation states

  • Model species-specific differences in MC1R structure based on sequence variation

  • Identify binding sites for agonists, antagonists, and signaling partners

  • Guide rational design of mutations to test structural hypotheses

Optogenetic and Chemogenetic Tools:

  • Develop light-activated or designer drug-activated MC1R variants

  • Control receptor activity with precise temporal resolution

  • Dissect the kinetics of MC1R signaling in real-time

  • Map the spatiotemporal dynamics of melanogenesis in response to MC1R activation

These advanced techniques would enable researchers to move beyond correlative studies to establish causal relationships between MC1R sequence, function, and pigmentation phenotypes in Papio anubis and other primates.

What are the implications of MC1R research for understanding primate evolution and adaptation?

MC1R research provides critical insights into primate evolution and adaptation, offering a molecular window into selective pressures that have shaped diversity:

Adaptive Significance of Pigmentation:

  • MC1R variants reveal how selection has acted on pigmentation across primate lineages

  • Different patterns of selection (purifying, diversifying, or balancing) indicate adaptive functions

  • MC1R polymorphisms in specific populations may reflect local adaptation to environmental conditions

  • Functional studies help distinguish neutral from adaptive variants

Mechanisms of Evolutionary Innovation:

  • Studies of Sulawesi macaques demonstrate how fixed differences in MC1R resulted in different functional characteristics, potentially contributing to rapid phenotypic divergence

  • MC1R research reveals how small genetic changes can produce significant phenotypic differences

  • Parallel evolution of similar MC1R variants in distant lineages may indicate convergent adaptation

Ecological and Social Drivers:

  • MC1R variation may reflect adaptation to different light environments or UV exposure levels

  • Pigmentation differences could facilitate species recognition in sympatric populations

  • Social selection might drive MC1R diversity in some primate lineages

Human Evolution Context:

  • Comparing human MC1R variants with those in other primates provides context for understanding human pigmentary adaptation

  • Studies in non-human primates help distinguish primate-wide patterns from human-specific evolutionary trajectories

Research on Papio anubis MC1R would contribute to this broader evolutionary picture, particularly given the ecological flexibility and wide geographic distribution of baboons across diverse African environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.