Recombinant Papio anubis Protein SYS1 homolog (SYS1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression System:

  • Host: Escherichia coli (E. coli)

  • Tag: N-terminal His tag for affinity purification

ParameterSpecification
Purity>90% (SDS-PAGE verified)
FormLyophilized powder
Molecular Weight~18 kDa (theoretical)

Applications in Research

  • SDS-PAGE: Used for protein size validation and purity assessment .

  • ELISA: Available as an ELISA-grade recombinant protein for antibody binding studies and immunoassays .

  • Functional Studies: Investigates SYS1’s role in vesicular trafficking and membrane protein sorting, given its homology to yeast SYS1 .

Research Context

Why Papio anubis?

Olive baboons are critical models for preclinical studies due to their genetic and physiological similarity to humans. For example, their immune cell responses to monoclonal antibodies closely mirror human reactions, making them ideal for immunotoxicity testing . The improved de novo genome assembly (Panubis1.0) further enhances genomic studies of baboon-derived proteins like SYS1 .

Comparative Genomics Insights
Hybridization events in Papio anubis history have shaped its genetic diversity, potentially influencing functional adaptations of proteins like SYS1 .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.

Tag type is determined during production. Please specify your desired tag type for preferential development.

Synonyms
SYS1; Protein SYS1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Papio anubis (Olive baboon)
Target Names
SYS1
Target Protein Sequence
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFST PPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWW LVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV
Uniprot No.

Target Background

Function

Involved in protein trafficking. May function as a receptor for ARFRP1.

Database Links

UniGene: Pan.1759

Protein Families
SYS1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining SYS1 protein stability?

For optimal stability, Recombinant Papio anubis SYS1 homolog protein should be stored at -20°C/-80°C, with -80°C preferred for extended storage periods . The recommended storage buffer is Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . To avoid protein degradation from freeze-thaw cycles, it is advisable to aliquot the protein and store working volumes at 4°C for up to one week . The shelf life is approximately 6 months for liquid formulations and 12 months for lyophilized forms when stored at -20°C/-80°C .

How does SYS1 homolog protein from Papio anubis compare structurally to human SYS1?

While the search results don't provide direct comparison data between human and Papio anubis SYS1, the use of baboon models in research is supported by the significant genetic and physiological similarities between baboons and humans . Baboons share many immunological similarities with humans and exhibit similar age-related physiological changes, making them valuable models for human health research . The SYS1 homolog protein belongs to a conserved family of proteins across mammalian species, with the baboon variant serving as a useful proxy for understanding human SYS1 function in experimental contexts.

What expression systems are most effective for producing functional Recombinant Papio anubis SYS1?

Based on the available information, E. coli has been successfully used as an expression system for producing recombinant Papio anubis SYS1 protein . The protein can be expressed with an N-terminal His-tag to facilitate purification . While E. coli is commonly used for its simplicity and high yield, researchers should consider the following factors when selecting an expression system:

Expression SystemAdvantagesConsiderations for SYS1 Production
E. coliHigh yield, cost-effective, rapid expressionMay lack post-translational modifications, potential for inclusion body formation
YeastEukaryotic PTMs, secretion capabilityLonger production time, different glycosylation patterns
Mammalian cellsNative-like PTMs, foldingHigher cost, lower yield, longer production time

For functional studies requiring post-translational modifications not provided by bacterial systems, mammalian expression systems might be preferable, though this would need to be validated experimentally for SYS1 specifically.

What purification methods yield the highest purity for Recombinant Papio anubis SYS1?

For His-tagged Recombinant Papio anubis SYS1, immobilized metal affinity chromatography (IMAC) is the primary purification method . The purification process typically yields protein with greater than 90% purity as determined by SDS-PAGE . For optimal results, a multi-step purification protocol is recommended:

  • Initial capture using IMAC with Ni-NTA or Co2+ resins

  • Intermediate purification using ion-exchange chromatography based on the protein's isoelectric point

  • Polishing step with size-exclusion chromatography to remove aggregates and achieve final purity

Researchers should verify protein purity using SDS-PAGE and consider Western blotting to confirm identity and integrity of the target protein. For applications requiring extremely high purity, additional chromatographic steps may be necessary.

What reconstitution methods are recommended for lyophilized SYS1 protein?

For reconstitution of lyophilized Recombinant Papio anubis SYS1 protein, the following protocol is recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the most common) to enhance stability

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

This method helps maintain protein activity while preventing degradation from multiple freeze-thaw cycles.

How is SYS1 homolog protein utilized in aging research with baboon models?

While the search results don't specifically mention SYS1's role in aging research, baboons have been established as valuable models for aging studies . Recent research has demonstrated age-associated alterations in immune and inflammatory responses in olive baboons, with significant age effects on numerous immune parameters .

Baboons show similar patterns of immunosenescence to humans, including:

  • Decreased monocytes, B cells, and NK cells in aged baboons

  • Significant linear relationships between age and absolute lymphocytes that decrease with advancing age

  • Increased inflammatory cytokine responses (INFγ and TNFα) to mitogen stimulation in older baboons

Researchers working with SYS1 could potentially investigate its role in these age-related changes, particularly if SYS1 is involved in cellular trafficking or signaling pathways relevant to immune function.

What experimental methods can be used to assess the functional activity of Recombinant Papio anubis SYS1?

While the search results don't provide specific functional assays for SYS1, standard methods for assessing recombinant protein activity can be applied:

  • Binding assays: Based on the methodology used for other Papio anubis proteins, functional ELISA can determine binding activity

  • Cellular localization studies: Immunofluorescence microscopy to determine proper subcellular localization

  • Protein-protein interaction studies: Co-immunoprecipitation or yeast two-hybrid screening to identify interaction partners

  • Flow cytometry: For proteins involved in cell surface expression or cellular trafficking

For comparison, the functional activity of other Papio anubis recombinant proteins, such as Oviduct-specific glycoprotein, has been determined by binding ability in functional ELISA assays . Similar approaches could be adapted for SYS1, focusing on its specific biological functions.

How does genetic variation in SYS1 across baboon populations impact experimental design?

Genomic studies have revealed complex population histories and hybridization among baboon species . This genetic diversity has important implications for researchers working with SYS1:

  • Population-specific variations: Genetic analysis of baboons has identified over 54.6 million single-nucleotide variants (SNVs) across the genus Papio, with >42.4 million variable within Papio . These variations could potentially affect SYS1 structure and function.

  • Hybridization effects: Evidence of ancient and recent hybridization among divergent baboon species suggests researchers should consider the genetic background of their baboon models, as hybridization could introduce functional variants of SYS1.

  • Experimental controls: When designing experiments, researchers should:

    • Document the specific origin of their Papio anubis samples

    • Consider potential population-specific effects on SYS1 function

    • Include appropriate controls to account for genetic background variation

This is particularly important when comparing results across studies using baboons from different populations or facilities.

How can epigenetic modification of the SYS1 gene be assessed in aging baboon models?

Recent research has developed methods for analyzing epigenetic modifications in baboons, which could be applied to the SYS1 gene:

Reduced representation bisulfite sequencing (RRBS) has been successfully used to quantify DNA methylation at base level resolution in baboon genomes . This methodology could be adapted to specifically examine the SYS1 locus:

  • Extract genomic DNA from tissues of interest from baboons of different ages

  • Construct RRBS libraries and sequence using next-generation sequencing platforms

  • Map reads to the baboon papAnu4 reference genome

  • Exclude positions with known polymorphisms to avoid errors

  • Analyze CpG methylation patterns specifically in the SYS1 gene region

Studies have shown that baboons exhibit age acceleration and deceleration patterns in their epigenetic ages , suggesting that analysis of SYS1 methylation could reveal age-related modifications that might impact gene expression.

What are the methodological considerations when comparing SYS1 function between captive and wild baboon populations?

Research indicates significant differences between captive and wild baboon populations that could impact SYS1 studies:

  • Microbiome differences: Wild baboons have richer microbial diversity compared to captive populations , which could influence immune function and potentially SYS1-related pathways.

  • Pathogen exposure: Conventional baboons show greater T-cell proliferation to stimulation with phytohemagglutinin or PWM, and higher IFNγ-producing cells after stimulation with Con A or PWM compared to specific pathogen-free (SPF) colonies .

  • Environmental factors: Factors such as social environment, social status, and habitat characteristics affect immune cell composition beyond age-related changes .

Methodological recommendations:

  • Clearly document the source population (wild, free-ranging, or captive)

  • Consider whether natural immune system development (conventional model) or controlled pathogen exposure (SPF model) is more appropriate for the specific research question

  • Include appropriate controls when comparing results across different baboon populations

  • Consider the potential impact of early life and social factors on SYS1 expression and function

What are the most common challenges in obtaining functional Recombinant Papio anubis SYS1 and how can they be addressed?

Based on general recombinant protein production principles and the specific information about SYS1, researchers may encounter several challenges:

ChallengePotential Solutions
Low protein solubility- Optimize expression temperature (typically lower temperatures improve solubility)
- Use solubility-enhancing fusion tags (SUMO, MBP, etc.)
- Modify buffer conditions (pH, salt concentration)
- Consider codon optimization for the expression system
Protein aggregation- Include stabilizing agents in the buffer (glycerol, trehalose)
- Optimize protein concentration during storage
- Ensure proper reconstitution of lyophilized protein
Loss of activity during storage- Store at -80°C for extended periods
- Add 50% glycerol for freezer storage
- Aliquot to avoid repeated freeze-thaw cycles
- Keep working aliquots at 4°C for no more than one week
Protein degradation- Include protease inhibitors during purification
- Optimize buffer pH to minimize autolysis
- Use high-purity reagents to minimize contaminant proteases

How can researchers validate the functional integrity of SYS1 after reconstitution or thawing?

To confirm that Recombinant Papio anubis SYS1 protein maintains its functional integrity after reconstitution or thawing, researchers should consider:

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Dynamic light scattering to check for aggregation

  • Functional assays:

    • Binding assays with known interaction partners

    • Activity assays specific to the protein's function

    • Cellular assays to confirm biological activity

  • Quality controls:

    • SDS-PAGE to verify size and purity

    • Western blot to confirm identity

    • Mass spectrometry to verify the intact mass and detect potential degradation

For SYS1 specifically, purity should be greater than 90% as determined by SDS-PAGE , which can serve as a basic quality control check after reconstitution.

How does the immune function of SYS1 in baboons inform human immunosenescence research?

While the search results don't provide specific information about SYS1's role in immune function, baboons have been established as valuable models for understanding immunosenescence:

Baboons exhibit age-related immune changes similar to humans, including:

  • Reduced production and function of B and T cells associated with poor clinical outcomes

  • Significant decreases in monocytes, B cells, and NK cells in aged individuals

  • Linear relationship between age and decreasing lymphocyte counts

These similarities make baboons an excellent model for studying age-related immune dysfunction and developing interventions. Research using Recombinant Papio anubis SYS1 could potentially:

  • Explore its role in immune cell trafficking or signaling

  • Investigate age-related changes in SYS1 expression or function

  • Develop targeted interventions to address specific aspects of immunosenescence

This research could inform human studies, given the genetic, physiological, and immunological similarities between baboons and humans .

What methodological approaches are most appropriate for cross-species comparisons of SYS1 function?

For researchers conducting cross-species comparisons involving SYS1, several methodological approaches are recommended:

  • Sequence alignment and structural analysis:

    • Compare amino acid sequences across species to identify conserved domains

    • Use homology modeling to predict structural similarities and differences

    • Identify potentially functionally important residues that are conserved across species

  • Functional assays:

    • Develop standardized assays that can be applied across species

    • Control for species-specific factors that might influence assay outcomes

    • Include appropriate positive and negative controls for each species

  • Expression analysis:

    • Use comparable tissue/cell types across species

    • Employ RNA-seq or quantitative PCR with carefully validated references genes

    • Consider developmental timing differences between species

  • Considerations for baboon-human comparisons:

    • Account for the genetic similarity between baboons and humans, particularly for immune-related genes

    • Consider the impact of evolutionary history, including potential hybridization effects in baboon populations

    • Note that while baboons share many immunological similarities with humans, species-specific differences in immune cell expression and function exist

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.