Recombinant Papio anubis Sugar transporter SWEET1 (SLC50A1)

What is Sugar Transporter SWEET1 (SLC50A1) and why study it in Papio anubis models?

Sugar Transporter SWEET1, officially designated as SLC50A1 (Solute Carrier Family 50 Member 1), is a membrane protein involved in sugar transport across cellular membranes . The Papio anubis (Olive baboon) version of this protein is particularly valuable for research because baboons are among the most commonly used non-human primates in biomedical research, second only to macaques . The baboon model offers significant advantages for translational research due to its physiological similarities to humans while providing distinct comparative insights not available in human studies.

The full amino acid sequence of Papio anubis SWEET1 consists of 221 amino acids (MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDRILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQLLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATVLTSASWCLYGFRLRVPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWFLQT), making it suitable for various structural and functional analyses .

How does the recombinant Papio anubis SWEET1 protein compare structurally to its human ortholog?

The recombinant Papio anubis SWEET1 protein (UniProt: Q95KW8) shares significant structural homology with its human counterpart (UniProt: Q9BRV3) . Both proteins function as sugar transporters and belong to the same solute carrier family. The human SWEET1 is also known by several synonyms including RAG1AP1, SCP, HsSWEET1, and RAG1-activating protein 1 .

The expression region for both proteins spans amino acids 1-221, indicating conservation of protein length between species . This conservation makes the Papio anubis model particularly valuable for comparative studies and translational research. Researchers can exploit these similarities to develop hypotheses about human SWEET1 function while leveraging the experimental advantages of working with non-human primate tissue and recombinant proteins.

What are the recommended storage and handling conditions for recombinant Papio anubis SWEET1 protein?

For optimal stability and activity of recombinant Papio anubis SWEET1 protein, storage at -20°C is recommended for routine use, while long-term storage is better at -20°C or -80°C . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and functionality . Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw damage .

The protein is typically supplied in a Tris-based buffer containing 50% glycerol optimized for this specific protein . When reconstituting lyophilized protein, it is recommended to briefly centrifuge the vial prior to opening to ensure all material is at the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage after reconstitution, adding glycerol to a final concentration of 5-50% is recommended before aliquoting and freezing .

What experimental approaches are recommended for studying SWEET1 function in membrane transport assays?

For investigating the membrane transport functions of recombinant Papio anubis SWEET1, several methodological approaches are recommended:

• Liposome Reconstitution Assays: Purified recombinant SWEET1 can be incorporated into liposomes with fluorescent sugar analogs inside. The transport activity is then measured by monitoring the efflux of these analogs over time using spectrofluorometry.

• Cell-Based Transport Assays: Expression of recombinant SWEET1 in cell lines with low endogenous sugar transporter expression (such as HEK293 or CHO cells) allows measurement of sugar uptake using radiolabeled sugars or fluorescent sugar analogs.

• Patch-Clamp Electrophysiology: For studying potential electrogenic properties of SWEET1, patch-clamp techniques can be used after expression in Xenopus oocytes or mammalian cell lines.

• Comparative Studies: Parallel experiments with human SWEET1 (Q9BRV3) can provide valuable insights into conserved and divergent functional aspects .

When designing these experiments, it is crucial to include appropriate controls such as non-transfected cells or liposomes without incorporated SWEET1, as well as established sugar transporters with known properties as positive controls.

How can recombinant Papio anubis SWEET1 be used for antibody production and validation?

Recombinant Papio anubis SWEET1 protein represents an excellent immunogen for antibody production due to its high purity (typically >90% as determined by SDS-PAGE) . For antibody production and validation, the following methodological approach is recommended:

• Immunization Protocol:

  • Primary immunization: 100 μg recombinant SWEET1 with complete Freund's adjuvant

  • Booster immunizations: 50 μg protein with incomplete Freund's adjuvant at 2-week intervals

  • Collection of serum 10-14 days after the final boost

• Antibody Validation Strategy:

  • ELISA: Using recombinant SWEET1 as the capture antigen

  • Western blotting: Against recombinant protein and Papio anubis tissue lysates

  • Immunoprecipitation: Using the antibody to pull down endogenous SWEET1

  • Immunohistochemistry: On fixed Papio anubis tissues expressing SWEET1

• Cross-Reactivity Assessment:

  • Test against human SWEET1 to determine cross-species reactivity

  • Evaluate specificity against other SWEET family transporters

The full-length nature of the available recombinant protein (1-221 amino acids) makes it particularly valuable for generating antibodies that recognize multiple epitopes, increasing the likelihood of success in various applications .

What are the methodological considerations for using ELISA with recombinant Papio anubis SWEET1?

When developing or using ELISA systems with recombinant Papio anubis SWEET1, several methodological considerations should be addressed:

Buffer Optimization Table for SWEET1 ELISA Development:

Methodological Considerations:

• Antigen Coating Strategy: As SWEET1 is a membrane protein, direct coating may result in improper orientation. Consider using capture antibodies directed against the tag on the recombinant protein (if present) or using detergent-solubilized membrane preparations.

• Standard Curve Preparation: Use the recombinant SWEET1 protein to create a standard curve ranging from 0.1-1000 ng/mL, with each standard prepared in triplicate to ensure statistical validity.

• Assay Validation Parameters:

  • Determine the limit of detection (typically 3× standard deviation of blank)

  • Evaluate intra-assay (within-plate) and inter-assay (between-plate) variability

  • Assess recovery by spiking known amounts of recombinant SWEET1 into sample matrix

  • Test linearity of dilution using samples with high SWEET1 concentration

• Cross-Reactivity Testing: Evaluate potential cross-reactivity with other SWEET family transporters or related proteins to ensure specificity of the assay.

The biological activity of recombinant Papio anubis proteins can be determined by their binding ability in functional ELISA systems, similar to methodologies used for other recombinant proteins from this species .

How can comparative genomics approaches be used to study SWEET1 evolution across primate species?

Leveraging the high-quality genome assembly of Papio anubis (Panubis1.0, with N50 contig size of ~1.46 Mb) , researchers can implement sophisticated comparative genomics approaches to study SWEET1 evolution:

• Phylogenetic Analysis Protocol:

  • Extract SLC50A1 gene sequences from multiple primate genomes

  • Align sequences using MUSCLE or MAFFT algorithms

  • Construct phylogenetic trees using maximum likelihood methods

  • Calculate evolutionary rates (dN/dS ratios) to identify signatures of selection

• Synteny Analysis:

  • Examine conservation of gene order and neighboring genes around SLC50A1

  • Identify potential evolutionary events such as inversions, translocations, or duplications

  • Use chromosome-level assembly data from Panubis1.0, which spans all 20 autosomes and the X chromosome

• Regulatory Element Comparison:

  • Identify conserved non-coding sequences upstream and downstream of SLC50A1

  • Predict transcription factor binding sites in these regions

  • Test functionality of putative regulatory elements using reporter assays

• Protein Structure Prediction:

  • Generate structural models of SWEET1 proteins from different primates

  • Identify conserved and variable regions that may impact function

  • Correlate structural differences with habitat and dietary adaptations

The Panubis1.0 assembly provides a solid foundation for these analyses, with 15,213 contigs assembled into 11,145 scaffolds and 22 chromosomes built, offering significantly improved resolution over previous assemblies .

What are the challenges and solutions in expressing functional recombinant Papio anubis SWEET1 in heterologous systems?

Expressing functional membrane proteins like Papio anubis SWEET1 presents several challenges. The following table outlines these challenges and methodological solutions:

How can recombinant Papio anubis SWEET1 be utilized in structural biology studies?

Structural biology studies of membrane proteins like SWEET1 require specialized approaches. The following methodological framework is recommended for studying recombinant Papio anubis SWEET1:

• Protein Production Optimization:

  • Scale-up expression using bioreactors with controlled dissolved oxygen and pH

  • Implement feeding strategies to maximize biomass and protein yield

  • Optimize purification to obtain homogeneous, stable protein preparations

  • Perform thermal stability assays to identify stabilizing conditions

• Crystallization Strategies:

  • Employ lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

  • Screen detergents systematically (maltosides, glucosides, neopentyl glycols)

  • Use surface entropy reduction mutations to promote crystal contacts

  • Implement crystallization chaperones (antibody fragments, nanobodies)

• Cryo-EM Approaches:

  • Reconstitute SWEET1 in nanodiscs or amphipols to maintain native-like environment

  • Optimize grid preparation conditions (concentration, buffer composition)

  • Implement focused refinement strategies for flexible regions

  • Consider conformational locking strategies to capture specific states

• Computational Analysis Pipeline:

  • Generate homology models based on existing SWEET family structures

  • Perform molecular dynamics simulations to study conformational dynamics

  • Implement enhanced sampling techniques to explore transport mechanisms

  • Identify conserved structural features across species using the resolved structures

The high-quality recombinant protein, with its full amino acid sequence characterized, provides an excellent starting point for these structural studies . Comparative analysis with human SWEET1 structures (when available) would provide valuable insights into conserved mechanisms and species-specific adaptations.

How does Papio anubis SWEET1 function compare to SWEET family transporters in other organisms?

The SWEET family of transporters is evolutionarily conserved across eukaryotes, with distinctive features in different lineages. A comparative analysis of Papio anubis SWEET1 reveals significant insights:

• Cross-Species Functional Conservation:
  Papio anubis SWEET1 belongs to the SLC50 family, which evolved from bacterial semiSWEETs through gene duplication and fusion events. The protein retains the core transport mechanism while acquiring primate-specific regulatory features. The amino acid sequence includes conserved transmembrane domains crucial for forming the sugar transport pathway, particularly the regions VVFTLGMFSAG and VLLGVLLLGYGY which contain signature motifs for sugar recognition and transport .

• Substrate Specificity Variations:
  While plant SWEET transporters often show broad specificity for multiple sugars, mammalian SWEET1 transporters including the Papio anubis ortholog demonstrate higher specificity for glucose. This specialization reflects adaptation to the more controlled nutrient environment in mammals compared to plants, which require more versatile transporters for various carbohydrates.

• Regulatory Mechanism Differences:
  Unlike plant SWEETs, which are often targets of pathogen effectors, primate SWEET1 transporters have evolved different regulatory mechanisms focused on metabolic control rather than pathogen defense. The Papio anubis SWEET1 contains potential phosphorylation sites not present in plant orthologs, suggesting differential post-translational regulation.

• Evolutionary Rate Analysis:
  Comparative genomic analysis using the Panubis1.0 assembly indicates that SWEET1 has evolved under purifying selection in primates, with key functional domains showing higher conservation than linking regions. This evolutionary pattern underscores the physiological importance of maintaining SWEET1 function across primate species.

What does comparative analysis reveal about tissue-specific expression patterns of SWEET1 in Papio anubis versus humans?

Comparative analysis of SWEET1 expression patterns between Papio anubis and humans provides valuable insights into both conserved and divergent aspects of its biological roles:

Expression Pattern Comparison Table:

The gene annotation of Papio anubis was carried out using a combination of protein-to-genome alignments, annotation mapping from suitable reference species, and RNA-seq alignments . This comprehensive approach provides confidence in the comparative expression data, though direct experimental validation through techniques like qPCR or immunohistochemistry remains valuable for confirming these patterns.

How can recombinant Papio anubis SWEET1 be used to investigate the evolution of sugar metabolism in primates?

Recombinant Papio anubis SWEET1 provides a powerful tool for investigating the evolution of sugar metabolism in primates through several methodological approaches:

• Functional Transport Assays Across Species:

  • Compare transport kinetics of recombinant SWEET1 from Papio anubis, humans, and other primates

  • Measure substrate specificity using a panel of different sugars

  • Determine temperature and pH optima to correlate with species physiology

  • The resulting data can illuminate how dietary adaptation has shaped transporter function

• Ancestral Sequence Reconstruction and Testing:

  • Infer ancestral SWEET1 sequences at key nodes in primate evolution

  • Express these reconstructed proteins as recombinants

  • Compare functional properties to extant proteins

  • This approach can reveal the trajectory of functional evolution

• Chimeric Protein Analysis:

  • Create chimeric proteins by swapping domains between Papio anubis and human SWEET1

  • Express these as recombinant proteins

  • Map functional differences to specific protein regions

  • This strategy identifies key domains that have undergone adaptive changes

• Ecological Correlation Studies:

  • Analyze SWEET1 sequence variation across primates with different diets

  • Correlate molecular changes with dietary specializations

  • Test functional hypotheses using recombinant proteins

  • This approach connects molecular evolution to ecological adaptation

The baboon's wide distribution across Africa, spanning diverse habitats from savannah and grassland steppe to rainforest , makes Papio anubis SWEET1 particularly valuable for understanding how sugar transport mechanisms adapt to different ecological niches and dietary patterns.

What are the critical quality control parameters for recombinant Papio anubis SWEET1 protein production?

Ensuring consistent quality of recombinant Papio anubis SWEET1 protein is essential for reliable research outcomes. The following quality control parameters and methodologies are critical:

Quality Control Parameter Matrix:

For recombinant Papio anubis proteins, including SWEET1, purity is typically determined by SDS-PAGE and should exceed 90% . The protein is commonly provided in a Tris-based buffer with 50% glycerol specifically optimized for this protein . This formulation helps maintain stability during storage and handling.

Additionally, for membrane proteins like SWEET1, detergent screening is a critical quality control step to ensure proper solubilization without compromising structure or function. The choice of detergent can significantly impact downstream applications, particularly for functional and structural studies.

What are the recommended approaches for studying SWEET1 protein-protein interactions in Papio anubis cell systems?

Investigating protein-protein interactions (PPIs) involving SWEET1 in Papio anubis cellular systems requires specialized approaches due to its membrane localization. The following methodological framework is recommended:

• Co-Immunoprecipitation Strategy:

  • Generate cell lysates from Papio anubis tissues or cultured cells

  • Use anti-SWEET1 antibodies coupled to solid support (protein A/G beads)

  • Optimize lysis conditions (detergent type and concentration) to maintain interactions

  • Identify co-precipitating proteins by mass spectrometry

  • Validate key interactions by reverse co-IP and functional assays

• Proximity Labeling Approaches:

  • Create fusion proteins of SWEET1 with promiscuous biotin ligases (BioID, TurboID)

  • Express in Papio anubis cell lines or primary cells

  • Induce biotinylation of proximal proteins

  • Purify biotinylated proteins using streptavidin

  • Identify interacting partners by mass spectrometry

• Mammalian Two-Hybrid System:

  • Adapt conventional two-hybrid for membrane proteins

  • Use split ubiquitin or split luciferase systems

  • Clone Papio anubis SWEET1 and potential interactors

  • Measure reporter gene activation as indication of interaction

  • Validate with orthogonal methods

• Fluorescence-Based Interaction Assays:

  • Implement FRET (Förster Resonance Energy Transfer) with fluorescently tagged proteins

  • Apply FLIM (Fluorescence Lifetime Imaging Microscopy) for quantitative analysis

  • Use BiFC (Bimolecular Fluorescence Complementation) for visualization of interactions

  • Perform live-cell imaging to capture dynamic interactions

The olive baboon has been established as a valuable model for various research applications , and these PPI methodologies can be effectively implemented in Papio anubis cell systems when studying SWEET1 interactions. The availability of the comprehensive Panubis1.0 genome assembly facilitates the design of species-specific tools for these studies, improving specificity and reducing off-target effects.

What advanced analytical techniques are recommended for characterizing post-translational modifications of Papio anubis SWEET1?

Post-translational modifications (PTMs) of membrane transporters like SWEET1 can significantly impact their function, localization, and regulation. For comprehensive characterization of PTMs in Papio anubis SWEET1, the following advanced analytical approaches are recommended:

• Mass Spectrometry-Based PTM Mapping:

  • Sample Preparation Protocol:

    • Enrich for SWEET1 using immunoprecipitation or affinity purification

    • Perform on-bead or in-gel digestion with multiple proteases (trypsin, chymotrypsin, Glu-C)

    • Implement peptide fractionation strategies (SCX, high-pH RP)

  • MS Analysis Strategy:

    • Use HCD/ETD complementary fragmentation methods

    • Implement data-dependent and data-independent acquisition

    • Apply targeted approaches (PRM, MRM) for quantification

    • Search against Papio anubis database derived from the Panubis1.0 assembly

• Site-Specific PTM Analysis:

  • Phosphorylation: TiO2 enrichment followed by LC-MS/MS

  • Glycosylation: Lectin affinity enrichment or hydrazide chemistry

  • Ubiquitination: K-ε-GG antibody enrichment after tryptic digestion

  • Acetylation: PTMScan® acetyl-lysine motif antibodies

• Functional Impact Assessment:

  • Generate site-directed mutants (phosphomimetic, phosphodeficient)

  • Compare transport activity, subcellular localization

  • Analyze protein stability and turnover rates

  • Assess impact on protein-protein interactions

• Temporal Dynamics Analysis:

  • Pulse-chase labeling with stable isotopes (SILAC)

  • Time-course experiments after physiological stimuli

  • Quantify changes in modification stoichiometry

  • Correlate with functional alterations

The full-length recombinant Papio anubis SWEET1 protein, spanning amino acids 1-221 , provides an excellent reference standard for these analyses. When performing comparative studies, the human ortholog can serve as a valuable comparison point to identify conserved and species-specific modifications .

What are the most promising future research directions for Papio anubis SWEET1 in comparative physiology studies?

The study of Papio anubis SWEET1 offers several promising avenues for future research in comparative physiology:

• Dietary Adaptation Studies: Baboons occupy diverse ecological niches across Africa, from savannah to rainforest habitats . Investigating how SWEET1 function correlates with dietary patterns can illuminate metabolic adaptations. This research could involve comparing sugar transport kinetics across baboon populations with different diets and correlating functional differences with specific sequence variations.

• Developmental Regulation: Examining how SWEET1 expression and function change during development in Papio anubis can provide insights into the ontogeny of metabolic systems. This approach could leverage the baboon's value as a developmental model and the available genomic resources .

• Cross-Species Comparative Physiology: With the availability of recombinant proteins from both Papio anubis and humans , direct functional comparisons can reveal evolutionary adaptations in sugar transport mechanisms. These studies could be extended to include other primate species, creating a broader evolutionary context.

• Integration with Microbiome Research: Investigating how SWEET1 function in the gut epithelium influences and is influenced by the gut microbiome represents an emerging frontier. Baboons, with their varied diets and habitats, provide an excellent model for such studies.

The high-quality genome assembly (Panubis1.0) and available recombinant proteins position Papio anubis as an invaluable model for these comparative physiology studies, bridging the gap between rodent models and human research.

How can researchers effectively integrate recombinant protein studies with in vivo Papio anubis models?

Integrating recombinant protein studies with in vivo Papio anubis models requires a thoughtful methodological approach that maximizes translational value while addressing ethical considerations:

• Translational Research Pipeline:

  • Begin with in vitro characterization of recombinant SWEET1 properties

  • Develop cell-based assays using Papio anubis primary cells

  • Validate findings in ex vivo tissue preparations

  • Design targeted in vivo studies based on previous findings

  • This staged approach ensures that in vivo studies are well-informed and focused

• Physiological Correlation Framework:

  • Measure SWEET1 expression in various tissues of Papio anubis

  • Correlate with functional parameters (glucose uptake, metabolism)

  • Develop tissue-specific functional assays

  • Use recombinant proteins to develop and validate assay systems

  • This framework connects molecular mechanisms to physiological outcomes

• Intervention Strategy Development:

  • Design modulators of SWEET1 function based on recombinant protein studies

  • Test in cell systems before in vivo application

  • Implement targeted delivery approaches to relevant tissues

  • Monitor both molecular and physiological outcomes

  • This approach leverages recombinant protein findings for targeted interventions

• Ethical Implementation Considerations:

  • Apply the 3Rs principle (Replacement, Reduction, Refinement)

  • Use recombinant proteins and in vitro systems to reduce animal usage

  • Design studies with appropriate statistical power to minimize subject numbers

  • Implement non-invasive monitoring where possible

  • This ensures responsible use of animal models

The olive baboon has already been established as a valuable model for various research applications, including reproductive and surgical research . The "Chai technique" developed for intrauterine procedures in baboons illustrates how species-specific methodologies can be developed to address research challenges .

What technical advances are needed to further optimize recombinant Papio anubis SWEET1 for structural and functional studies?

Despite significant progress in recombinant protein technology, several technical advances could substantially improve the utility of recombinant Papio anubis SWEET1 for structural and functional studies:

• Expression System Optimization:

  • Development of specialized mammalian expression systems tailored for primate membrane proteins

  • Engineering of cell lines with reduced endogenous sugar transporter background

  • Implementation of inducible expression systems with fine-tuned regulation

  • These advances would improve yield and functional quality of the recombinant protein

• Structural Stabilization Strategies:

  • Design of conformation-specific nanobodies or antibody fragments as crystallization chaperones

  • Implementation of systematic mutagenesis to identify stabilizing mutations

  • Development of novel detergent or lipid systems that better mimic the native membrane environment

  • These approaches would enhance success in structural biology applications

• Functional Assay Advancement:

  • Development of high-throughput fluorescence-based transport assays

  • Engineering of SWEET1-specific biosensors for real-time activity monitoring

  • Implementation of microfluidic systems for precise control of transport conditions

  • These tools would enable more detailed functional characterization

• Integration With Computational Approaches:

  • Refinement of molecular dynamics simulations specifically parameterized for SWEET transporters

  • Development of machine learning models to predict the impact of sequence variations

  • Implementation of quantum mechanics/molecular mechanics (QM/MM) approaches for transport mechanism studies

  • These computational tools would complement experimental approaches