Recombinant Papio anubis Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism and Hematopoietic Effects

ST7 exhibits multi-lineage hematopoietic activity by modulating STAT-5 phosphorylation, a pathway shared with growth factors like IL-3, GM-CSF, and erythropoietin (EPO) . Unlike traditional cytokines, ST7 bypasses receptor dependency, directly activating downstream signaling to promote cell proliferation and survival .

Key Functional Insights:

  • Myeloid Progenitor Stimulation:

    • Enhances CFU-GM (colony-forming unit-granulocyte/macrophage) colony formation in human cord blood and peripheral blood progenitors .

    • ST7-S (S-enantiomer) increases colony numbers by ~1.7-fold compared to untreated controls .

  • Neutrophil Survival:

    • Inhibits apoptosis in mature human neutrophils, matching the efficacy of G-CSF .

    • Prolongs viability in cytokine-deprived conditions, preserving functional capacity .

  • Radiation Response:

    • Accelerates myeloid recovery in sub-lethally irradiated mice, reducing neutropenia duration .

    • Improves survival in lethally irradiated mice when administered orally post-exposure .

In Vitro and In Vivo Models

ModelObservationRelevance
Human NeutrophilsST7 prevents apoptosis, maintaining viability comparable to G-CSF .Therapeutic potential for neutropenia.
Irradiated MiceST7-S accelerates marrow recovery and increases platelet counts .Radiation exposure mitigation.
Normal BaboonsST7 and ST7-S elevate absolute neutrophil counts and platelets without stress .Translational implications for cytopenias.

Applications and Handling Guidelines

ST7 is primarily used in research settings for functional assays, with strict handling protocols:

ParameterRecommendation
ReconstitutionUse deionized sterile water (0.1-1.0 mg/mL) with 5-50% glycerol for stability .
Storage-20°C/-80°C (aliquoted); avoid repeated freeze-thaw cycles .
Purity AssuranceSDS-PAGE validation (>90% purity) .

Comparative Analysis with Hematopoietic Factors

ST7 distinguishes itself from conventional cytokines by its receptor-independent mechanism and enantiomer-specific activity :

FeatureST7IL-3/GM-CSF
Receptor DependencyBypasses receptors Requires specific receptors
Enantiomer ActivityST7-S more potent than ST7-R No enantiomer specificity
Multi-Lineage EffectsMyeloid, erythroid, and HSC support Lineage-specific (e.g., IL-3 for myeloid)

Research Gaps and Future Directions

While ST7 shows promise in hematopoietic recovery, further studies are needed to:

  1. Elucidate its interaction with Bcl-2 family proteins in apoptosis regulation .

  2. Assess long-term safety and efficacy in non-human primate models.

  3. Explore combinatorial therapies with other Hemokines™ or cytokines.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Papio anubis (Olive baboon)
Target Names
ST7
Target Protein Sequence
MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYVLRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMSDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN
Uniprot No.

Target Background

Database Links

UniGene: Pan.6758

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the ST7 gene and its protein product in Papio anubis?

ST7 (Suppressor of Tumorigenicity 7) is a gene originally identified as a candidate tumor suppressor located on chromosome 7q31.1 in humans. In Papio anubis (olive baboon), the ST7 gene encodes a protein that functions similarly to its human counterpart, exhibiting tumor suppressive properties . The full-length protein consists of 585 amino acids and plays a role in inhibiting tumor growth and development . Multiple transcript variants of the ST7 gene have been identified in Papio anubis, including variants X1 through X16, suggesting complex regulation and potentially diverse functions of this protein .

What evidence supports ST7's role as a tumor suppressor?

Multiple lines of evidence demonstrate ST7's tumor suppressive function:

  • In vivo studies: ST7 has been shown to suppress the growth of PC-3 prostate cancer cells when inoculated subcutaneously into severe combined immunodeficient mice, increasing tumor detection latency from 13 days in control tumors to 23 days .

  • In vitro studies: Re-expression of ST7 has been associated with suppression of colony formation under anchorage-independent conditions in MDA-MB-231 breast cancer cells .

  • Clinical observations: ST7 mRNA expression was found to be downregulated in 44% of primary breast cancers, suggesting its loss may contribute to tumor development .

  • Mechanistic studies: Expression profiling of PC-3 cells revealed that ST7 predominantly induces changes in genes involved in remodeling the extracellular matrix, including SPARC, IGFBP5, and several matrix metalloproteinases .

How can recombinant Papio anubis ST7 protein be expressed and purified for research?

Methodological approach:

  • Vector selection: Use either the standard pcDNA3.1+/C-(K)DYK vector or a customized vector depending on experimental requirements .

  • Cloning method: Employ the CloneEZ™ Seamless cloning technology for inserting the ST7 ORF into the expression vector .

  • Expression system options:

    • Yeast expression systems have been successfully used for recombinant protein production of Papio anubis proteins

    • Mammalian cell lines (such as HEK293) may be preferred when post-translational modifications are critical

  • Purification strategy:

    • Add a C-terminal DYKDDDDK (FLAG) tag to facilitate purification using anti-FLAG affinity chromatography

    • Perform size exclusion chromatography as a secondary purification step

    • Verify protein purity using SDS-PAGE (>90% purity is standard for research applications)

  • Quality control:

    • Confirm protein identity by mass spectrometry

    • Verify biological activity through functional assays such as ELISA

What are optimal storage conditions for recombinant ST7 protein?

For maximum stability and activity preservation of recombinant ST7 protein:

  • Store in a Tris-based buffer with 50% glycerol optimization .

  • For long-term storage, maintain at -20°C or -80°C .

  • Working aliquots can be stored at 4°C for up to one week .

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity .

How can researchers effectively analyze ST7 mutations in tumor samples?

Based on methodologies used in previous ST7 mutation studies, the following approach is recommended:

  • Sample preparation:

    • Extract high-quality genomic DNA from primary tumor tissues or cell lines

    • Include matched normal tissue when available for comparison

  • Mutation detection methods:

    • PCR-SSCP (Polymerase Chain Reaction-Single-Strand Conformational Polymorphism) analysis for initial screening

    • Design intronic primers for each genomic region to capture exon-intron boundaries

    • Focus on critical exons (3, 5, and 12) that have previously shown mutations

  • Verification:

    • Confirm any mobility shifts by direct DNA sequencing

    • When using next-generation sequencing approaches, validate findings with Sanger sequencing

  • Analysis strategy:

    • Compare mutation rates in different cancer types

    • Distinguish between missense mutations and protein-truncating mutations

    • Correlate findings with clinical data when available

ExonMutation TypeFrequency in Previous StudiesReference
3Protein-truncating4 cases reported
5Protein-truncating2 cases reported
12Protein-truncating1 case reported

How should researchers interpret conflicting data regarding ST7's role as a tumor suppressor?

The controversy surrounding ST7's designation as the key tumor suppressor gene at the 7q31 locus requires careful data interpretation:

  • Context-dependent effects:

    • Consider tumor type specificity - ST7's suppressive effects may be more pronounced in certain cancers (e.g., prostate and breast) than others

    • Examine cell line variations - different cell lines may exhibit different responses to ST7 manipulation

  • Methodological considerations:

    • Evaluate functional assays versus mutational analyses - functional studies show ST7 behaves as a tumor suppressor, but mutation frequencies vary between studies

    • Compare in vitro versus in vivo data - ST7's effects in cell culture may differ from those in animal models

  • Statistical approach:

    • Perform meta-analysis when comparing across studies

    • Use appropriate statistical tests for small sample sizes often encountered in mutation studies

    • Consider publication bias in evaluating the literature

  • Resolution strategies:

    • Design experiments that can directly address conflicting findings

    • Test ST7 function across multiple model systems

    • Characterize the complete molecular pathway rather than focusing solely on ST7

How can researchers accurately analyze multiple transcript variants of ST7?

The analysis of ST7 transcript variants requires strategic approaches:

  • Transcript identification:

    • Design primers that can distinguish between different variants

    • Use RNA-seq data to quantify relative abundance of different variants

    • Consider that Papio anubis ST7 has at least 16 transcript variants (X1-X16)

  • Expression analysis:

    • Employ variant-specific qRT-PCR to quantify individual transcript levels

    • Use Northern blotting to confirm size differences between variants

    • Consider tissue-specific expression patterns

  • Functional differentiation:

    • Clone individual variants for functional testing

    • Perform rescue experiments with specific variants

    • Compare protein domains present in different variants

Transcript VariantAccession NumberNotesReference
X1XM_009203730.3Papio anubis ST7 transcript variant X1
X2XM_009203731.4Papio anubis ST7 transcript variant X2
X4XM_009203733.3Papio anubis ST7 transcript variant X4
X8XM_009203737.4Papio anubis ST7 transcript variant X8

What mechanisms underlie ST7-mediated suppression of tumor growth?

Current evidence suggests ST7 functions through multiple mechanisms:

  • Extracellular matrix remodeling:

    • ST7 predominantly induces changes in genes involved in ECM remodeling

    • Key targets include SPARC (Secreted Protein Acidic and Rich in Cysteine), IGFBP5 (Insulin-like Growth Factor Binding Protein 5), and several matrix metalloproteinases

    • These changes may affect cell migration, invasion, and adhesion properties

  • Methodological approaches to study these mechanisms:

    • RNA-seq or microarray analysis to identify differentially expressed genes following ST7 manipulation

    • ChIP-seq to identify direct ST7 transcriptional targets

    • Protein interaction studies to map ST7's protein-protein interaction network

    • Focused functional assays to validate individual pathway components

  • Experimental validation strategies:

    • Generate ST7 knockout models using CRISPR-Cas9

    • Create point mutations in key functional domains

    • Perform rescue experiments with wild-type and mutant ST7

    • Use pharmacological inhibitors of downstream pathways

How does ST7 degradation regulate its tumor suppressive function?

Understanding ST7 protein stability and degradation mechanisms is critical:

  • Degradation pathway:

    • Based on studies of other tumor suppressors, ST7 is likely degraded via the ubiquitin-proteasome pathway

    • Methodologically, this can be investigated using proteasome inhibitors such as MG132

    • Pulse-chase experiments with fluorescently tagged ST7 can measure protein half-life

  • Ubiquitination analysis:

    • Immunoprecipitate ST7 and probe with anti-ubiquitin antibodies

    • Look for high molecular weight smears typical of polyubiquitinated proteins

    • Identify potential E3 ligases responsible for ST7 ubiquitination

  • Stability regulation:

    • Investigate post-translational modifications that affect ST7 stability

    • Examine how cancer-associated mutations affect protein half-life

    • Study context-dependent regulation in different tissues and stress conditions

What is the evolutionary conservation of ST7 across primate species and what does this reveal about its function?

Understanding the evolutionary aspects of ST7 provides insights into its fundamental functions:

  • Comparative genomic analysis:

    • Compare ST7 sequences across primates including Papio anubis, Macaca nemestrina, and human

    • Identify conserved domains and regulatory elements

    • Determine selection pressures on different protein regions

  • Functional conservation studies:

    • Test whether ST7 from different species can complement each other functionally

    • Compare tissue expression patterns across species

    • Identify species-specific interaction partners

  • Methodological approaches:

    • Phylogenetic analysis of ST7 sequences

    • Synteny analysis to examine conservation of genomic context

    • Structural modeling to predict functional consequences of sequence differences

What are the common challenges when working with recombinant ST7 protein?

Researchers should anticipate and address these common challenges:

  • Protein solubility issues:

    • ST7 may have hydrophobic regions that reduce solubility

    • Optimize expression conditions (temperature, induction time)

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Test different detergents for membrane-associated portions

  • Activity preservation:

    • Develop functional assays to confirm biological activity

    • Optimize buffer conditions to maintain protein stability

    • Consider co-factors that might be necessary for activity

  • Experimental controls:

    • Include both positive and negative controls in all experiments

    • Use known interacting partners as positive controls

    • Consider using related proteins as specificity controls

How can researchers validate potential ST7 genome assembly errors in Papio anubis?

When working with Papio anubis ST7 sequences, researchers should be aware of potential genome assembly errors:

  • Common assembly issues:

    • Potential inversions, misplaced contigs, and translocations have been identified in the Panubis1.0 genome assembly

    • 16 potential inversions, 3 misplaced contigs, and 1 potential translocation were noted in a quality control analysis

  • Validation methods:

    • Use linkage disequilibrium (LD)-based estimates of recombination using tools like pyrho

    • Examine recombination rates at putative synteny breaks, which are typically ~20 times higher than in flanking sequences

    • Compare with other primate genomes to identify inconsistencies

  • Impact on research:

    • Be cautious when analyzing regions identified as potential NCO (non-crossover) tracts of 10-100 kb, as 9 out of 10 such regions were consistent with assembly errors

    • Verify gene structures through independent methods such as long-read sequencing or targeted PCR

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.