Recombinant Papio anubis Transmembrane protein 50B (TMEM50B)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

TMEM50B belongs to the transmembrane protein family, characterized by its role in cellular membrane structures and potential involvement in signaling or transport pathways. The recombinant form is produced in bacterial, yeast, or mammalian systems, enabling controlled studies of its structure and function .

Primary Sequence and Domains

The full-length TMEM50B from Papio anubis spans 158 amino acids (1–158), with a predicted transmembrane topology. Key structural features include:

  • N-terminal signal peptide: MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHT

  • Transmembrane domains: Hydrophobic regions (e.g., IFFTGWWIMIDAAVVYPKPEQLNHAFHT) critical for membrane integration .

  • C-terminal motifs: CGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT .

PropertyFull-Length (E. coli)Partial (Yeast/Mammalian)
Expression SystemE. coliYeast/Mammalian cells
TagN-terminal His-tagUndetermined (varies)
Purity>90% (SDS-PAGE)>85% (SDS-PAGE)
Molecular Weight~18 kDa (predicted)Partial sequence
Source

Production and Quality Control

TMEM50B is produced via recombinant expression systems, with variations in yield and post-translational modifications:

  • Bacterial Expression (E. coli):

    • Produces full-length protein with His-tag for affinity purification .

    • Purity >90% confirmed via SDS-PAGE .

  • Yeast/Mammalian Systems:

    • Partial sequences (exact length unspecified) expressed in yeast or mammalian cells .

    • Purity >85% achieved, but glycosylation patterns differ from bacterial systems .

Reconstitution:
Lyophilized protein is reconstituted in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol (v/v) for stability .

Applications in Research

TMEM50B is primarily used in:

  1. Structural Biology: SDS-PAGE analysis to confirm molecular weight and purity .

  2. Immunological Studies: Potential use in antibody production or epitope mapping .

  3. Functional Assays: Hypothetical role in membrane protein interactions or trafficking (inferred from homology to human TMEM50B) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in development.
Synonyms
TMEM50B; Transmembrane protein 50B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Papio anubis (Olive baboon)
Target Names
TMEM50B
Target Protein Sequence
MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHT CGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGA YVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT
Uniprot No.

Target Background

Database Links

UniGene: Pan.16254

Protein Families
UPF0220 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What are the genomic characteristics of TMEM50B in Papio anubis?

The genomic structure of TMEM50B in Papio anubis can now be more accurately studied using the recently improved genome assembly (Panubis1.0). While specific details about the baboon TMEM50B genomic structure are not fully documented in the available literature, we can extrapolate some features from human TMEM50B and the general improvements in the baboon genome assembly.

Human TMEM50B is located on chromosome 21q22.11 and contains 11 exons . In Papio anubis, the gene would be found on one of the 20 autosomes or the X chromosome that have been successfully assembled as single scaffolds in the Panubis1.0 assembly .

For researchers interested in the genomic context of TMEM50B in Papio anubis, the Panubis1.0 assembly provides a significant improvement over the previous Panu_3.0 assembly, with an N50 contig size of ~1.46 Mb (compared to 139 kb) and single scaffolds spanning each of the 20 autosomes and the X chromosome . This improved assembly facilitates more accurate analysis of gene structure, regulatory elements, and genomic context.

What expression systems are recommended for recombinant production of Papio anubis TMEM50B?

For optimal recombinant expression of Papio anubis TMEM50B, researchers should consider multiple expression systems, each with distinct advantages:

Mammalian Expression Systems:

  • HEK293 or CHO cells provide mammalian post-translational modifications

  • Recommended for functional studies requiring native protein conformation

  • Can be used with transient transfection or stable cell line approaches

  • Expression vectors containing CMV or EF1α promoters typically yield good expression levels

Insect Cell Systems:

  • Baculovirus-infected Sf9 or High Five™ cells often yield higher protein amounts

  • Provide most post-translational modifications but with slightly different glycosylation patterns

  • Useful for structural studies requiring larger protein quantities

Cell-Free Systems:

  • Rapid screening approach with microsomal membrane supplementation

  • Good for initial construct optimization before moving to cellular systems

For transmembrane proteins like TMEM50B, the expression vector design should include appropriate affinity tags (His, FLAG) for purification while ensuring these tags don't interfere with protein folding or function. Based on commercial availability of similar proteins, standard vectors like pcDNA3.1+/C-(K)DYK can be used for expression of TMEM50B ORF clones .

What purification strategies work best for recombinant TMEM50B protein?

Purifying recombinant TMEM50B presents challenges typical of multi-pass transmembrane proteins. A systematic approach includes:

Membrane Preparation:

  • Gentle cell lysis methods to preserve native structure (nitrogen cavitation or sonication)

  • Differential centrifugation to isolate membrane fractions

  • Removal of peripheral proteins with high salt or alkaline pH washes

Solubilization Optimization:

  • Screening multiple detergents (DDM, LMNG, CHAPS) at various concentrations

  • Testing detergent:protein ratios to find optimal solubilization conditions

  • Consider adding cholesterol or specific lipids to stabilize the protein

Chromatography Sequence:

  • Immobilized metal affinity chromatography (IMAC) using His-tags

  • Size exclusion chromatography to remove aggregates and detergent micelles

  • Optional ion exchange step for removal of specific contaminants

Stabilization Methods:

  • Addition of glycerol (10-20%) to prevent aggregation

  • Specific lipid supplementation if required for stability

  • Consideration of nanodiscs or amphipols for detergent-free preparation

Throughout the purification process, it's essential to monitor protein integrity using techniques like SDS-PAGE, Western blotting, and thermal shift assays to ensure the recombinant TMEM50B maintains its native conformation.

How can researchers verify the functionality of purified recombinant TMEM50B?

Verifying the functionality of recombinant TMEM50B requires multiple complementary approaches:

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure content

  • Thermal shift assays to measure protein stability under various conditions

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify proper oligomeric state

Localization Studies:

  • Fluorescently tagged TMEM50B expression in mammalian cells

  • Co-localization with endoplasmic reticulum markers

  • Trafficking studies to confirm proper cellular distribution

Functional Reconstitution:

  • Incorporation into proteoliposomes or nanodiscs

  • Assays examining interaction with predicted binding partners

  • If transport function is confirmed, development of transport assays measuring substrate movement

Protein-Protein Interaction Verification:

  • Pull-down assays with known interacting partners

  • Surface plasmon resonance (SPR) to measure binding affinities

  • Co-immunoprecipitation from cells expressing recombinant protein

These verification methods should be compared with native TMEM50B when possible, though this is challenging due to typically low endogenous expression levels.

How do evolutionary differences in TMEM50B between baboon species inform primate genetic studies?

Analysis of TMEM50B sequences across baboon species can provide valuable insights into primate evolution:

Phylogenetic Analysis Applications:

  • TMEM50B sequence data contributes to understanding the evolutionary relationships within the Papio genus

  • Particularly valuable for examining differences between northern clade (including Guinea baboon and olive baboons from Nigeria, Cameroon and Ivory Coast) and southern clade (including south chacma from South Africa and coastal Namibia)

  • Can help resolve evolutionary divergence times, with major splits in baboon lineages occurring approximately 1.34-1.89 million years ago

Hybridization and Introgression Studies:

  • TMEM50B as a nuclear marker can be compared with mitochondrial data to detect evidence of hybridization

  • Important for understanding "nuclear swamping" phenomena, where hybridization followed by repeated asymmetric backcrossing results in individuals with mitochondria from one species but nuclear genomic signatures from another

  • Particularly relevant in regions where olive baboons and hamadryas baboons overlap, where hybrid females preferentially mate with olive males

Methodological Approaches:

  • Maximum likelihood or Bayesian phylogenetic analyses

  • Selection pressure analysis (dN/dS ratios) to identify conserved functional domains

  • Comparative analysis with human TMEM50B to identify primate-specific adaptations

The improved baboon genome assembly (Panubis1.0) provides a better reference for these comparative studies, allowing more accurate identification of orthologous sequences and regulatory elements .

What methods are most effective for studying TMEM50B protein-protein interactions?

Investigating TMEM50B protein-protein interactions requires specialized approaches for membrane proteins:

Proximity-Based Methods:

  • BioID or APEX2 fusion proteins expressed in appropriate cell lines

  • In vivo biotinylation of proximal proteins followed by streptavidin purification

  • Mass spectrometry identification of interaction partners

  • Advantages: captures weak and transient interactions in native cellular environment

Membrane-Specific Yeast Two-Hybrid Systems:

  • Split-ubiquitin or MYTH (Membrane Yeast Two-Hybrid) systems

  • Screening against cDNA libraries from relevant baboon tissues

  • Bait constructs must be designed to ensure proper membrane insertion

  • Advantages: allows high-throughput screening for binary interactions

Crosslinking Mass Spectrometry:

  • Chemical crosslinking of intact cells expressing TMEM50B

  • Enrichment of crosslinked complexes and proteomic analysis

  • Identification of interaction interfaces at amino acid resolution

  • Advantages: provides structural information about interaction sites

Comparative Interactomics:

  • Side-by-side analysis of TMEM50B interactomes across species

  • Identification of conserved and species-specific interaction partners

  • Correlation with functional differences between orthologs

  • Advantages: evolutionary insights into protein function

Successful interaction studies require validation using multiple orthogonal techniques and careful consideration of the membrane environment to maintain physiologically relevant interactions.

How can structural biology approaches inform TMEM50B function in endosomal transport?

Structural characterization of TMEM50B can provide critical insights into its molecular function:

Cryo-Electron Microscopy (Cryo-EM):

  • Most promising approach for membrane protein structure determination

  • Sample preparation in detergent micelles, nanodiscs, or amphipols

  • Single particle analysis for high-resolution structure determination

  • Advantages: can capture multiple conformational states relevant to transport function

Integrative Structural Biology:

  • Combining lower-resolution experimental data with computational modeling

  • Cross-linking mass spectrometry to identify distance constraints

  • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

  • Advantages: builds comprehensive structural models when high-resolution structures are challenging

Functional Domain Mapping:

  • Systematic mutagenesis of conserved residues

  • Structure-function correlation through functional assays

  • Identification of regions essential for endosomal sorting

  • Advantages: directly connects structural features to protein function

Comparative Structural Analysis:

  • Homology modeling based on related proteins with known structures

  • Evolutionary conservation mapping onto structural models

  • Identification of functional motifs involved in transport pathways

  • Advantages: leverages existing structural knowledge to generate testable hypotheses

These structural approaches can reveal how TMEM50B participates in late endosome to vacuole transport via multivesicular body sorting pathways, as predicted by current functional annotations .

What are the key considerations when designing CRISPR-based studies of TMEM50B in Papio anubis cells?

CRISPR-Cas9 studies of TMEM50B in Papio anubis require careful experimental design:

Guide RNA Design:

  • Utilize the improved Panubis1.0 genome assembly for accurate sgRNA design

  • Target conserved exons essential for protein function

  • Design multiple sgRNAs to increase success probability

  • Verify target site conservation between the reference genome and your specific baboon cell line

Off-Target Analysis:

  • Perform comprehensive off-target prediction specific to the Papio anubis genome

  • Include controls to assess off-target effects

  • Consider using high-fidelity Cas9 variants to minimize off-target editing

Functional Rescue Experiments:

  • Complementation with wild-type or mutant TMEM50B variants

  • Species cross-complementation to test functional conservation

  • Inducible expression systems to control timing of rescue

Phenotypic Assays:

  • Endosomal trafficking visualization using fluorescent markers

  • Cargo sorting efficiency measurement

  • Cell viability and proliferation assessment

  • Stress response evaluation, particularly ER stress given TMEM50B's localization

Cell Line Considerations:

  • Whenever possible, use baboon-derived cell lines to maintain species-specific genetic context

  • Consider immortalized fibroblasts or lymphoblastoid cell lines from Papio anubis

  • For comparative studies, perform parallel experiments in human cell lines

These CRISPR-based approaches can provide valuable insights into TMEM50B function while maintaining the specific genetic context of Papio anubis.

How can recombinant TMEM50B be used to study evolutionary adaptations in membrane trafficking across primates?

Comparative studies of TMEM50B across primates can reveal evolutionary adaptations in membrane trafficking:

Cross-Species Functional Complementation:

  • CRISPR knockout of endogenous TMEM50B in model cell lines

  • Rescue experiments with TMEM50B orthologs from various primates

  • Quantitative assessment of functional rescue efficiency

  • Identification of species-specific functional differences

Protein-Protein Interaction Network Evolution:

  • Standardized interactome mapping for TMEM50B from multiple primate species

  • Network analysis to identify conserved and lineage-specific interactions

  • Correlation with species-specific adaptations in endosomal trafficking

  • Functional validation of evolutionary innovations

Structural Variation Analysis:

  • Homology modeling of TMEM50B from different primates

  • Mapping of species-specific variations onto structural models

  • Molecular dynamics simulations to predict functional consequences

  • Experimental validation of structure-based predictions

Expression Pattern Comparison:

  • Analysis of tissue-specific expression patterns across primates

  • Identification of regulatory changes affecting expression

  • Correlation with species-specific physiological adaptations

  • Implications for using baboon models in human disease research

Methodological Approach Table:

Evolutionary AspectExperimental ApproachExpected OutcomeSignificance
Functional ConservationCross-species complementationDegree of functional rescueBasic functional conservation across primates
Specialized AdaptationsSite-directed mutagenesis of species-specific residuesIdentification of functionally important adaptationsSpecies-specific membrane trafficking adaptations
Regulatory EvolutionPromoter analysis and reporter assaysDifferences in expression regulationEvolutionary changes in gene regulation
Interaction NetworksComparative interactomicsConserved vs. species-specific interactionsEvolution of protein interaction networks
Selection PressuredN/dS analysis across primate TMEM50B sequencesSites under positive or purifying selectionMolecular evolution patterns

These approaches provide a framework for using recombinant TMEM50B to understand how membrane trafficking pathways have evolved across primate lineages, with implications for both basic evolutionary biology and translational research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.