Recombinant Papio hamadryas C-C chemokine receptor type 5 (CCR5)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Papio hamadryas CCR5 is typically produced in Escherichia coli systems for research applications. Key steps include:

  • Expression: Codon-optimized gene insertion with an N-terminal His-tag for affinity purification .

  • Purification: Nickel-column chromatography followed by detergent solubilization to maintain structural integrity .

  • Quality Control:

    • Purity: >97% via SDS-PAGE .

    • Bioactivity: Validated via ligand-binding assays (e.g., CCL5 inhibition) .

Stability: Maintained in PBS with 5% trehalose at -80°C, avoiding freeze-thaw cycles .

HIV/SIV Entry Studies

  • Coreceptor Function: Baboon CCR5 facilitates SIVmac entry into CD4+ T cells, mimicking human HIV-1 interactions . Structural studies reveal that SIVgp120 mimics chemokine binding to CCR5, exploiting conserved regions like ECL2 and the N-terminus .

  • Antagonist Screening: Maraviroc (FDA-approved CCR5 antagonist) shows reduced binding affinity in cholesterol-enriched membranes, highlighting lipid-environment dependencies .

Chemokine Signaling

  • Pathway Activation: Ligand binding triggers Gαi-mediated signaling and β-arrestin recruitment, modulating immune cell migration and cytokine release .

  • Dimerization: CCR5 forms homo-/heterodimers with CCR2 or opioid receptors, altering ligand specificity and signaling outcomes .

Species-Specific Adaptations

  • Baboon-Specific Mutations: Serial passage of SIVmac in baboon PBMC selects for viral variants with enhanced CCR5 utilization, evading chemokine-mediated blockade (e.g., via CCL3L1) .

Comparative Analysis: Human vs. Baboon CCR5

FeatureHuman CCR5Baboon CCR5
HIV/SIV TropismPrimary co-receptor for HIV-1 (R5 strains)Utilized by SIVmac variants
Ligand AffinityHigh affinity for CCL5 and CCL3Similar but with altered sulfation patterns
Genetic PolymorphismΔ32 mutation confers HIV resistanceNo reported Δ32 analogs

Challenges and Innovations

  • Structural Plasticity: CCR5’s conformational flexibility complicates drug design but enables broad ligand recognition .

  • Expression Systems: Pichia pastoris and cell-free systems improve yield for structural studies (e.g., cryo-EM) .

  • Therapeutic Targeting: Engineered chemokine analogs like 5P12-RANTES show enhanced CCR5 blockade, resisting viral evasion .

Future Directions

  • HIV Cure Strategies: CRISPR-edited CCR5 knockout in hematopoietic stem cells .

  • Cancer Immunotherapy: Targeting CCR5+ cancer stem cells in triple-negative breast cancer .

  • Neuroprotection: CCR5 antagonists in clinical trials for stroke and Alzheimer’s disease .

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type in advance, and we will prioritize its inclusion.
Synonyms
CCR5; CMKBR5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CD antigen CD195
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Uniprot No.

Target Background

Function
This receptor binds several inflammatory CC-chemokines, including CCL3/MIP-1α, CCL4/MIP-1β, and RANTES. Binding initiates intracellular signaling, increasing calcium ion levels. CCR5 may regulate granulocytic lineage proliferation and differentiation and facilitates T-lymphocyte migration to infection sites by acting as a chemotactic receptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural relationship between Papio hamadryas CCR5 and human CCR5?

Papio hamadryas CCR5, like its human counterpart, is a seven-transmembrane G protein-coupled receptor belonging to the beta chemokine receptor family . While the exact sequence homology must be experimentally determined, primate CCR5 proteins generally maintain high conservation in the transmembrane domains and ligand-binding regions. To properly characterize the baboon CCR5, researchers should conduct sequence alignment analyses comparing the amino acid sequences with human CCR5, focusing particularly on the N-terminus and extracellular loops which are crucial for ligand interactions and co-receptor function .

Methodologically, researchers should:

  • Perform multiple sequence alignments using CLUSTAL or similar tools

  • Generate hydrophobicity plots to confirm the seven-transmembrane topology

  • Conduct homology modeling using human CCR5 crystal structures as templates

  • Verify key functional domains through site-directed mutagenesis studies

How do binding properties of Papio hamadryas CCR5 compare with human CCR5?

  • Establish binding assays using both fluorescence anisotropy and plasmon waveguide resonance for comprehensive evaluation

  • Compare binding affinities of various chemokines using competition binding assays

  • Validate findings using multiple expression systems to rule out artifacts

  • Consider membrane composition effects, particularly cholesterol content, which has been shown to decrease binding affinity of ligands such as maraviroc to human CCR5

What expression systems are optimal for producing functional recombinant Papio hamadryas CCR5?

Based on successful approaches with human CCR5, researchers have several viable expression systems to consider:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, established protocols Limited post-translational modifications, inclusion body formationStructural studies, antibody production
Pichia pastorisProper folding, glycosylation patterns, high yield Longer production timeFunctional studies, binding assays
Cell-free expressionRapid production, direct membrane incorporationLower yield, higher costReconstitution studies, lipid interaction analyses
Mammalian cellsMost native-like processingLower yield, expensiveSignaling studies, complex formation

For functional studies, Pichia pastoris and cell-free expression systems have demonstrated success with human CCR5 . These systems allow for proper folding and facilitate subsequent reconstitution into lipid environments that maintain receptor functionality. For structural studies where glycosylation may be less critical, E. coli-based expression with subsequent refolding protocols can provide sufficient quantities of protein .

How does membrane composition affect Papio hamadryas CCR5 stability and function?

Membrane composition, particularly cholesterol content, significantly impacts CCR5 function. Studies with human CCR5 demonstrate that cholesterol decreases the binding affinity of ligands like maraviroc to the receptor . For Papio hamadryas CCR5:

  • Researchers should systematically vary lipid compositions in reconstituted systems, particularly:

    • Cholesterol content (0-40%)

    • Phospholipid head group composition

    • Acyl chain length and saturation

  • Functional assessment should include:

    • Ligand binding studies using fluorescence anisotropy

    • Conformational dynamics via hydrogen-deuterium exchange mass spectrometry

    • Thermal stability measurements using differential scanning calorimetry

  • Consider employing coarse-grained molecular dynamics simulations to investigate how cholesterol impacts receptor conformational flexibility, similar to approaches used with human CCR5

How should researchers approach studying CCR5 polymorphisms in Papio hamadryas?

The approach to studying CCR5 polymorphisms in baboons should build upon established methodologies used for human CCR5 variant analysis. Based on human studies, researchers should:

  • Conduct comprehensive sequencing of the CCR5 gene region in diverse Papio hamadryas populations

  • Focus on promoter regions and coding sequences, particularly regions corresponding to known functional human polymorphisms such as:

    • Promoter polymorphisms (corresponding to human rs2856758, rs2734648, rs1799987)

    • Coding region variants (corresponding to human rs1799988, rs1800023, rs1800024)

    • Potential deletion mutations (analogous to human Δ32/rs333)

  • Implement statistical analyses used successfully in human studies:

    • Principal component analyses to identify relationships between alleles

    • Haplotype determination using computational tools

    • Association studies with immune parameters or disease susceptibility

  • Consider the SNP2TFBS tool to identify variants that may influence transcription factor binding sites, as has been done with human CCR5 polymorphisms

What functional impacts do CCR5 haplotypes have on immune responses?

Human CCR5 haplotype studies provide a framework for investigating baboon CCR5 haplotype effects. In humans, specific CCR5 haplotypes significantly influence immune responses and disease progression:

  • Haplotypes containing -2459G/G (HHA/HHA, HHA/HHC, HHC/HHC) associate with enhanced delayed-type hypersensitivity responses and favorable disease outcomes in HIV infection

  • Haplotypes containing -2459A/A (HHE/HHE) correlate with reduced delayed-type hypersensitivity and accelerated disease progression

  • The CCR5-Δ32 allele's protective effect depends on the paired non-Δ32 haplotype, with:

    • Protective effect when paired with HHA or HHC (associated with low CCR5 expression)

    • Less protection when paired with HHE (associated with high CCR5 expression)

For Papio hamadryas CCR5 research, investigators should:

  • Develop equivalent haplotype designations based on baboon CCR5 sequences

  • Assess haplotype correlations with CCR5 expression levels in different immune cell populations

  • Evaluate functional immune parameters like delayed-type hypersensitivity responses across haplotype groups

  • Investigate disease susceptibility correlations in natural or experimental infection models

What controls are essential for CCR5 functional assays in reconstituted systems?

When designing functional assays for recombinant Papio hamadryas CCR5 in reconstituted systems, researchers must include multiple controls to ensure valid interpretation:

  • Protein quality controls:

    • SDS-PAGE analysis to confirm purity (>97% recommended)

    • Circular dichroism to verify proper folding

    • Size-exclusion chromatography to assess aggregation state

  • Reconstitution controls:

    • Empty liposomes/nanodiscs to distinguish receptor-specific signals

    • Systems with varying receptor densities to assess crowding effects

    • Reconstitutions with denatured receptor as negative controls

  • Experimental design controls:

    • Multiple lipid compositions, particularly varying cholesterol content

    • Parallel testing with human CCR5 for comparative analysis

    • Non-functional receptor mutants to confirm specificity

  • Ligand binding controls:

    • Unlabeled ligand competition assays

    • Known CCR5 antagonists (e.g., maraviroc) as reference compounds

    • Multiple detection methodologies (e.g., fluorescence anisotropy and plasmon waveguide resonance)

How should researchers design experiments to evaluate CCR5's role in cell-mediated immunity?

Based on established approaches with human CCR5, investigations of Papio hamadryas CCR5's role in cell-mediated immunity should:

  • Implement delayed-type hypersensitivity (DTH) assays:

    • Use established antigens like keyhole limpet hemocyanin (KLH) or purified protein derivative (PPD)

    • Measure induration at 24, 48, and 72 hours post-challenge

    • Correlate DTH responses with CCR5 genotypes and expression levels

  • Design in vitro T cell function studies:

    • Assess T cell proliferation in response to specific antigens

    • Measure cytokine production profiles (particularly Th1 cytokines)

    • Evaluate chemotactic responses to CCR5 ligands

  • Include genetic correlation analyses:

    • Sequence CCR5 from study subjects

    • Determine haplotypes using computational approaches

    • Group subjects by genotype for functional comparisons, as done in human studies

  • Consider modulating CCR5 function using:

    • Small molecule antagonists

    • Blocking antibodies

    • RNA interference approaches

How can Papio hamadryas CCR5 contribute to SIV/HIV research models?

Papio hamadryas CCR5 offers valuable opportunities for advancing SIV/HIV research, particularly when comparing with human CCR5 function as an HIV co-receptor . Researchers should:

  • Conduct comparative viral entry assays:

    • Express Papio hamadryas CCR5 in cell lines lacking endogenous co-receptors

    • Test entry efficiency of diverse SIV and HIV isolates

    • Compare with cells expressing human CCR5 under identical conditions

  • Evaluate binding interactions with viral envelope proteins:

    • Produce recombinant gp120 from various HIV/SIV strains

    • Conduct binding assays using surface plasmon resonance

    • Identify species-specific interaction differences

  • Investigate CCR5 antagonist effectiveness:

    • Test clinical and experimental CCR5 antagonists against baboon CCR5

    • Determine IC50 values compared to human CCR5

    • Identify structural determinants of any differential responses

  • Consider CCR5 genetic variants and their impact:

    • Determine if naturally occurring Papio hamadryas CCR5 variants affect viral entry

    • Investigate whether differential distribution of haplotypes correlates with SIV susceptibility

    • Compare with known protective variants in humans (e.g., CCR5-Δ32)

What methodologies are recommended for studying CCR5 signaling dynamics in baboon systems?

To study CCR5 signaling dynamics in Papio hamadryas systems, researchers should employ methodologies that capture both temporal and spatial aspects:

  • Real-time signaling assays:

    • BRET/FRET biosensors for G protein activation

    • Calcium flux measurements with ratiometric indicators

    • Phosphorylation-specific antibodies for downstream pathway activation

  • Spatial organization analysis:

    • Super-resolution microscopy to track receptor clustering

    • Single-molecule tracking to measure diffusion dynamics

    • Proximity labeling approaches to identify signaling partners

  • Systems biology approaches:

    • Phosphoproteomics to identify signaling networks

    • Transcriptomics to assess downstream gene regulation

    • Network analysis to identify species-specific signaling nodes

  • Comparative approaches:

    • Parallel studies in human and baboon primary cells

    • Chimeric receptor constructs to identify species-specific domains

    • Cross-species ligand panels to determine signaling biases

How should researchers address discrepancies between in vitro and in vivo CCR5 function?

Researchers frequently encounter discrepancies between in vitro and in vivo CCR5 functional data. To address these challenges:

  • Improve in vitro systems to better reflect physiological conditions:

    • Use primary cells rather than cell lines when possible

    • Implement co-culture systems that reflect tissue microenvironments

    • Utilize physiologically relevant ligand concentrations

    • Include appropriate lipid compositions in reconstituted systems, particularly cholesterol

  • Implement complementary methodological approaches:

    • Compare findings from multiple expression systems (e.g., Pichia pastoris and cell-free expression)

    • Utilize both recombinant protein and cellular systems

    • Employ multiple detection technologies (e.g., fluorescence anisotropy and plasmon waveguide resonance)

  • Bridge in vitro and in vivo findings with ex vivo approaches:

    • Analyze cells/tissues immediately after collection from in vivo studies

    • Implement tissue slice cultures to maintain cellular architecture

    • Correlate molecular findings with functional outcomes like delayed-type hypersensitivity

  • Apply statistical approaches that account for biological complexity:

    • Use multivariate analysis to identify confounding factors

    • Implement mixed-effects models for longitudinal data

    • Consider Bayesian approaches to integrate prior knowledge

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.