Recombinant Papio hamadryas Duffy antigen/chemokine receptor (DARC)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is typically produced in mammalian expression systems (e.g., HEK293) or E. coli for structural studies. A standardized purification protocol involves:

  • Extraction: Use of detergents like n-dodecyl-β-D-maltoside (DDM) and cholesteryl hemisuccinate (CHS) to solubilize membrane-bound DARC .

  • Affinity Chromatography: Immobilized anti-Fy6 monoclonal antibodies (e.g., 2C3) bind the N-terminal epitope (FEDVW motif), followed by elution with synthetic DFEDVWN peptide .

  • Purity: >80% by SDS-PAGE, with α-helical secondary structure confirmed via circular dichroism .

Functional Properties

  • Chemokine Scavenging: Binds pro-inflammatory chemokines (e.g., CCL2, CXCL8) with dissociation constants (K<sub>d</sub>) of 5–40 nM but does not signal via G proteins or β-arrestins .

  • Malaria Receptor: Serves as an entry portal for Plasmodium vivax merozoites in erythrocytes; recombinant forms enable studies on parasite inhibition .

Applications in Research

ApplicationUtility
ELISA and Binding AssaysQuantify chemokine interactions (e.g., CCL7 binding) or screen monoclonal antibodies .
Structural BiologyCryo-EM studies resolve ligand-receptor complexes (e.g., CCL7-DARC) to guide drug design .
Malaria ResearchEvaluate inhibitors blocking Plasmodium invasion using recombinant erythrocyte models .

Challenges and Limitations

  • Glycosylation Variability: Eukaryotic expression systems are required to replicate native glycan structures critical for ligand binding .

  • Stability Issues: Requires storage at -80°C in Tris-glycerol buffers to prevent aggregation .

  • Species-Specific Differences: Functional disparities between primate DARC orthologs may limit translational relevance to human biology .

Future Directions

  • High-Resolution Structures: Cryo-EM of Papio hamadryas DARC-chemokine complexes to refine binding mechanisms .

  • Therapeutic Targeting: Engineering DARC-derived decoy receptors to neutralize excess chemokines in inflammatory diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ACKR1; DARC; FY; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; CD antigen CD234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MGNCLHPAELSPSTQNSSQLNSEDLWNFSYDGNDSFPDVDYDANLEAAAPCHSCNLLDDS ALPFFILVSVLGILASGIVLFMFFRPLFHWQLCPGWPVLAQLAVGSALFSIVVPILAPGL GNTRSSALCSLGYCVWYGSAFAQALLLGCHASLGPKLGADQVPGLTLGLSVGLWGVAALL TLPVTLASGASGGLCTPVYSMELKALQATHAVACLAIFVLLPLGLFGAKGLKKALGMGPG PWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT PLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Uniprot No.

Target Background

Function
DARC is an atypical chemokine receptor that regulates chemokine levels and localization by binding chemokines with high affinity, but without triggering classic ligand-driven signaling cascades. This results in chemokine sequestration, degradation, or transcytosis. It is also known as interceptor (internalizing receptor), chemokine-scavenging receptor, or chemokine decoy receptor. DARC exhibits a promiscuous chemokine-binding profile, interacting with inflammatory chemokines from both the CXC and CC subfamilies, but not with homeostatic chemokines. It serves as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, and TARC. DARC may regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: When expressed in endothelial cells, it sustains abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes. When expressed in erythrocytes, it acts as a blood reservoir of cognate chemokines, but also as a chemokine sink, buffering potential surges in plasma chemokine levels.
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein.

Q&A

What is the Duffy antigen/chemokine receptor (DARC) and what are its primary functions?

DARC is a glycoprotein that functions as an atypical chemokine receptor, controlling chemokine levels and localization via high-affinity binding. Unlike typical chemokine receptors, DARC binding is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis . It serves multiple roles in the immune system, including:

  • Acting as a binding site for malarial parasites Plasmodium vivax and P. knowlesi

  • Functioning as a promiscuous chemokine receptor

  • Serving as a blood group antigen

DARC is also known by alternative terms including interceptor, chemokine-scavenging receptor, or chemokine decoy receptor. The protein regulates chemokine bioavailability and leukocyte recruitment through two distinct mechanisms: in endothelial cells, it facilitates transcytosis of tissue-derived chemokines for presentation to circulating leukocytes; in erythrocytes, it functions both as a blood reservoir for chemokines and as a chemokine sink, buffering potential surges in plasma chemokine levels .

What cellular and tissue expression patterns are observed for DARC?

DARC displays a distinctive expression pattern across different tissues and cell types:

  • Erythrocytes (red blood cells): DARC is expressed on the surface of RBCs in Duffy-positive individuals

  • Endothelial cells: DARC is specifically and intensely expressed on endothelial cells lining postcapillary venules throughout the body

  • Specialized endothelial cells: Strong expression is observed in littoral cells (specialized endothelial cells lining the sinusoids in the red pulp of the spleen), endothelial cells lining bone marrow sinusoids, and the choroid plexus

What evolutionary pressures have shaped DARC across primate species?

Research indicates that DARC experiences two opposing selective forces across Haplorhine primates:

  • Positive selection: Particularly at the Plasmodium binding site, suggesting adaptation against malarial infection

  • Purifying selection: At sites critical for chemokine binding and structural integrity

This evolutionary pattern reflects DARC's dual role as both a target for pathogen entry and an important immunoregulatory molecule. The conservation of four critical cysteine amino acids at positions 51, 129, 195, and 276 across Haplorhines demonstrates purifying selection preserving structural elements essential for DARC's function as a chemokine receptor . These extracellular cysteine residues play crucial structural roles in maintaining proper protein conformation.

Twenty sites in the chemokine receptor domain show evidence of purifying selection, highlighting regions where functional constraints have prevented amino acid changes throughout primate evolution .

How do mutations in DARC affect susceptibility to malaria in different primate species?

Mutations in the DARC gene, particularly in the region encoding the Fy6 antigen-binding site, can significantly affect susceptibility to Plasmodium infection. In black lion tamarins (Leontopithecus chrysopygus), studies have identified critical mutations (D21N, F22L, and V25L) that differentiate them from humans at the P. vivax and P. knowlesi binding site .

These mutations may prevent parasite binding to DARC, potentially conferring protection against malarial infection. This hypothesis is supported by experimental evidence showing that chemokines like MGSA, IL-8, and a mutant MGSA (MGSA-E 6A) can block invasion of human RBCs by P. knowlesi, which uses the Duffy antigen for invasion .

The Duffy-negative phenotype, common in approximately two-thirds of African Americans, results in the absence of DARC expression on erythrocytes and confers natural resistance to P. vivax infection, as these parasites cannot invade erythrocytes lacking the receptor .

What functional differences exist between human and Papio hamadryas DARC?

While both human and Papio hamadryas DARC function as atypical chemokine receptors and potential binding sites for Plasmodium, several functional differences are evident:

  • Binding affinity for Plasmodium species: Differences in the amino acid sequence at the Fy6 epitope, particularly at positions 21-25, likely affect the binding affinity for different Plasmodium species

  • Chemokine binding profile: While both display promiscuous chemokine binding, subtle differences in binding affinities for specific chemokines may exist

  • Immune response modulation: Variation in the extracellular domains may influence interactions with immune system components

Research examining these functional differences provides insights into species-specific adaptations and potential therapeutic targets. Comparative studies using recombinant proteins from both species enable detailed characterization of these functional differences .

What expression systems are optimal for producing functional recombinant Papio hamadryas DARC?

Several expression systems can be used to produce recombinant DARC, each with advantages for different experimental applications:

  • Wheat germ expression system: Used successfully for human DARC, this cell-free system produces proteins with proper folding and post-translational modifications suitable for structural and functional studies

  • Mammalian expression systems: Particularly useful when authentic glycosylation patterns are required for functional studies

  • Bacterial expression systems: Can be used for producing specific domains for structural studies, though often with limitations for full-length membrane proteins

When selecting an expression system, researchers should consider:

  • The intended experimental application (structural studies, binding assays, etc.)

  • Required post-translational modifications

  • Potential for proper folding of the seven-transmembrane domain structure

  • Scale of protein production needed

The expression tag used (often determined during the production process) should be considered for its potential impact on protein function and removed if necessary for downstream applications .

What purification strategies are most effective for recombinant DARC proteins?

Effective purification of recombinant DARC requires a multi-step approach, typically involving:

  • Initial capture: Affinity chromatography using the expression tag (e.g., His-tag, GST-tag)

  • Intermediate purification: Ion exchange chromatography to remove contaminants with different charge properties

  • Polishing: Size exclusion chromatography to achieve high purity and remove aggregates

For membrane proteins like DARC, detergent selection is critical throughout the purification process. Mild detergents such as DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) are often preferred to maintain native-like structure.

Storage recommendations include using a Tris-based buffer with 50% glycerol optimized for protein stability, with storage at -20°C for short-term use and -80°C for extended storage . Repeated freezing and thawing should be avoided, with working aliquots kept at 4°C for up to one week to maintain functional integrity.

What analytical methods are most informative for characterizing DARC structure and function?

Multiple analytical techniques provide complementary information about DARC structure and function:

  • Binding assays:

    • ELISA for quantitative assessment of chemokine binding affinities

    • Surface Plasmon Resonance (SPR) for real-time binding kinetics

    • Cross-linking experiments with 125I-labeled chemokines to identify binding partners

  • Structural analyses:

    • Circular Dichroism (CD) for secondary structure assessment

    • NMR or X-ray crystallography for high-resolution structural information

    • Cryogenic Electron Microscopy (cryo-EM) for visualizing membrane protein structure

  • Functional characterization:

    • Chemokine sequestration assays

    • Transcytosis measurements in cellular models

    • Invasion assays with Plasmodium parasites

  • Expression and localization studies:

    • Immunoblotting with specific antibodies (e.g., anti-Fy6)

    • Immunohistochemistry for tissue localization

    • Flow cytometry for cell surface expression

Researchers have successfully used cross-linking experiments with 125I-labeled MGSA (Melanoma Growth Stimulatory Activity, a chemokine) to identify DARC as a 35-43 kD protein. SDS-PAGE combined with immunoblotting using anti-Fy6 antibodies provides a complementary approach for protein characterization .

How does DARC mediate malarial parasite invasion of erythrocytes?

DARC serves as an essential receptor for the invasion of erythrocytes by Plasmodium vivax and P. knowlesi parasites. The molecular mechanism involves:

  • Initial recognition: The Duffy binding proteins (DBPs) of the parasite, specifically the 135-kD Duffy binding protein of P. knowlesi, bind to DARC on the erythrocyte surface

  • Receptor engagement: This interaction occurs at specific sites in the N-terminal extracellular domain of DARC

  • Parasite entry: Following binding, the parasite initiates the invasion process

Experimental evidence demonstrates that chemokines that bind DARC (MGSA, IL-8, and MGSA-E 6A) can competitively block parasite invasion by preventing the interaction between parasite DBPs and DARC . This competitive inhibition provides a potential therapeutic strategy and confirms the critical role of DARC in parasite entry.

In individuals with the Duffy-negative phenotype (Fy(a-b-)), the absence of DARC expression on erythrocytes renders them naturally resistant to P. vivax infection, as these parasites cannot invade erythrocytes lacking the receptor .

What role does DARC play in inflammatory conditions and immune regulation?

DARC plays complex roles in inflammatory conditions and immune regulation through several mechanisms:

  • Chemokine sequestration and transport:

    • On erythrocytes: Acts as both a reservoir for chemokines and a sink that buffers plasma chemokine levels

    • On endothelial cells: Facilitates transcytosis of tissue-derived chemokines from the abluminal to luminal surface, presenting them to circulating leukocytes

  • Inflammatory modulation:

    • Upregulation on larger vessels during inflammatory conditions (e.g., temporal arteritis, thrombophlebitis)

    • Potential role in leukocyte recruitment and trafficking

  • Immunoregulatory functions:

    • Buffering of chemokine gradients

    • Potential role in immunotolerance, particularly in contexts like fetal anastomosis in callitrichines

The expression of DARC specifically on postcapillary venules positions it at a critical interface for leukocyte extravasation during inflammation. Its promiscuous binding of both CXC and CC chemokine subfamilies allows it to regulate multiple inflammatory pathways simultaneously .

How might recombinant DARC be utilized in therapeutic applications?

Recombinant DARC offers several potential therapeutic applications:

  • Anti-malarial strategies:

    • Recombinant DARC or DARC-derived peptides could serve as decoys to prevent Plasmodium binding to erythrocytes

    • Understanding DARC-Plasmodium interactions may lead to vaccine development targeting this critical invasion step

  • Inflammatory disease modulation:

    • Recombinant DARC could potentially act as a chemokine sink to reduce inflammation in conditions characterized by chemokine dysregulation

    • DARC-derived molecules might modulate specific inflammatory pathways without affecting others

  • Diagnostic applications:

    • Recombinant DARC in ELISA and other assay formats for detecting chemokine levels

    • Potential biomarker for inflammatory conditions

  • Research tools:

    • Recombinant DARC as a tool for drug discovery, particularly for compounds that might block Plasmodium binding

The development of recombinant Papio hamadryas DARC provides a comparative tool to understand species-specific differences in these functions, potentially revealing evolutionary adaptations that could inform therapeutic design .

How do specific amino acid residues contribute to DARC's promiscuous chemokine binding profile?

DARC's ability to bind multiple chemokines from both CXC and CC subfamilies depends on specific structural features:

  • Critical binding domains:

    • The N-terminal extracellular domain contains key residues for chemokine recognition

    • The seven-transmembrane structure provides the architectural framework for binding

  • Essential residues:

    • Conserved cysteine residues at positions 51, 129, 195, and 276 play crucial structural roles in maintaining the correct conformation for chemokine binding

    • These cysteines are conserved across Haplorhine primates, indicating their fundamental importance

  • Evolutionary considerations:

    • Twenty sites showing purifying selection are likely critical for maintaining chemokine binding function

    • Sites under positive selection may contribute to species-specific variations in binding profiles

Advanced research methods including site-directed mutagenesis, binding affinity measurements, and structural studies would be required to fully characterize how specific residues contribute to DARC's unique binding properties. Comparative studies between human and Papio hamadryas DARC can identify specific amino acid differences that might affect chemokine binding preferences.

What mechanisms regulate DARC expression in different tissues and under various conditions?

The regulation of DARC expression shows tissue-specific patterns and responds to various conditions:

  • Cell type-specific expression:

    • Erythroid expression: Regulated by GATA-1 and other erythroid-specific transcription factors

    • Endothelial expression: Independent of the erythroid regulatory mechanisms, as evidenced by continued expression in Duffy-negative individuals

  • Inflammatory response:

    • DARC expression is upregulated on larger vessels during inflammatory conditions

    • The molecular mechanisms of this upregulation likely involve inflammatory cytokines and endothelial activation pathways

  • Developmental regulation:

    • Different expression patterns may exist during development

    • Expression in specialized tissues like the choroid plexus suggests specific regulatory mechanisms

Understanding these regulatory mechanisms requires approaches such as promoter analysis, chromatin immunoprecipitation, single-cell transcriptomics, and reporter gene assays in relevant cell types. The distinct regulation of DARC in erythroid versus endothelial lineages provides a fascinating model for studying tissue-specific gene regulation.

How does DARC's function as an atypical chemokine receptor differ from canonical chemokine receptors?

DARC differs fundamentally from canonical chemokine receptors in several key aspects:

  • Signaling capabilities:

    • Canonical receptors: Coupled to G-proteins, triggering intracellular signaling cascades upon chemokine binding

    • DARC: Uncoupled from classic ligand-driven signal transduction, functioning instead in chemokine sequestration, degradation, or transcytosis

  • Structural differences:

    • DARC lacks the DRYLAIV motif in the second intracellular loop that is essential for G-protein coupling in canonical receptors

    • This structural difference explains its inability to trigger classical signaling pathways

  • Functional consequences:

    • Rather than directly activating cells, DARC regulates chemokine bioavailability

    • Serves as a chemokine reservoir and sink, buffering chemokine levels

    • Facilitates transcytosis of chemokines across endothelial barriers

Advanced research approaches including detailed structural analysis, trafficking studies, and comparative signaling assays would further elucidate the molecular basis for these functional differences. Understanding DARC's atypical functions provides insights into the diverse roles of chemokine receptors beyond direct cell activation.

What are the implications of climate change for DARC-mediated malaria susceptibility in non-human primates?

Climate change could significantly impact DARC-mediated malaria susceptibility in non-human primates:

  • Changing Plasmodium distribution:

    • As climate patterns shift, the geographic range of various Plasmodium species may expand

    • For species like black lion tamarins (BLTs), mutations in the Fy6 antigen-binding site might provide protection should P. vivax distribution increase in their habitat

  • Host-parasite co-evolution:

    • Changes in parasite prevalence may alter selection pressures on DARC

    • Populations previously unexposed to certain Plasmodium species may face new selective pressures

  • Conservation implications:

    • Endangered primate species may face additional threats if more susceptible to emerging malarial infections

    • Understanding DARC variations across primate populations could inform conservation strategies

Research examining the binding efficiency of various Plasmodium species to DARC variants across primate species, combined with climate modeling of parasite distribution, would provide valuable insights into future infection risks. Such studies would be particularly relevant for conservation efforts focused on vulnerable primate populations .

How might DARC function be influenced by microRNA regulation and post-translational modifications?

DARC function can be significantly modulated by both microRNA regulation and post-translational modifications:

  • microRNA regulation:

    • Potential miRNA binding sites in DARC mRNA could influence tissue-specific expression patterns

    • Inflammation-responsive miRNAs might regulate DARC upregulation during inflammatory conditions

  • Post-translational modifications:

    • Glycosylation: Affects protein folding, stability, and ligand binding properties

    • Phosphorylation: May influence DARC's interactions with intracellular trafficking machinery

    • Ubiquitination: Could regulate DARC turnover and cell surface expression levels

  • Methodological approaches:

    • Mass spectrometry to identify specific modifications

    • Site-directed mutagenesis to determine functional consequences

    • miRNA inhibition/overexpression studies to assess regulatory effects

Understanding these regulatory mechanisms could reveal new approaches for modulating DARC function in disease contexts. Comparative studies between human and Papio hamadryas DARC might identify species-specific differences in these regulatory mechanisms that contribute to functional differences.

What role might DARC play in emerging infectious diseases beyond malaria?

DARC's potential role in infectious diseases extends beyond malaria:

  • Viral infections:

    • Some viruses utilize chemokine receptors for cell entry

    • DARC's ability to bind multiple chemokines raises questions about its potential interactions with viral proteins

  • Bacterial infections:

    • Chemokine regulation by DARC might influence immune responses to bacterial pathogens

    • Bacteria might exploit DARC-mediated transcytosis pathways

  • Emerging zoonotic diseases:

    • As a receptor conserved across primates but with species-specific variations, DARC could influence cross-species transmission of pathogens

    • Understanding these variations might help predict zoonotic disease risks

Research approaches including viral binding assays, bacterial infection models in DARC-manipulated cells, and comparative studies across species would help elucidate these potential roles. The promiscuous binding profile of DARC makes it a particularly interesting target for investigation in the context of emerging infectious diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.