Recombinant Papio hamadryas Proteinase-activated receptor 1 (F2R)

Shipped with Ice Packs
In Stock

Description

3.1. Oncology

F2R is implicated in tumorigenesis, particularly in gliomas. Overexpression of F2R promotes cell proliferation, metastasis, and epithelial-mesenchymal transition (EMT) via the WNT/β-catenin pathway. SOX2 transcriptionally regulates F2R expression, linking it to cancer progression .

Study FindingsMechanism
Glioma ProgressionF2R overexpression ↑ proliferation and metastasis via WNT/β-catenin
SOX2 RegulationSOX2 binds F2R promoter, ↑ F2R transcription and tumor growth
Therapeutic TargetPAR1 inhibitors (e.g., vorapaxar) reduce tumor burden in preclinical models

3.2. Cardiovascular and Vascular Development

F2R mediates thrombin-induced platelet activation and vascular remodeling. In zebrafish, par1 knockdown disrupts cardiovascular development, highlighting its conserved role in vascular signaling .

Physiological RoleExperimental Evidence
Platelet ActivationThrombin cleavage of F2R induces platelet aggregation
Vascular DevelopmentPAR1 deficiency causes embryonic hemorrhage in mice and vascular defects in zebrafish

3.3. Inflammatory and Fibrotic Diseases

F2R contributes to inflammatory responses and fibrosis, particularly in lung diseases. Its activation by proteases like thrombin or MMPs exacerbates inflammation and tissue remodeling .

Pathological RoleKey Findings
Lung FibrosisF2R activation ↑ inflammatory cytokine release and fibroblast proliferation
MMP-12 SignalingMMP-12 cleaves F2R, ↑ Egr-1 expression, and promotes fibrogenesis

Challenges and Future Directions

While recombinant F2R models are invaluable, challenges include maintaining receptor functionality post-expression and mimicking native membrane environments. Advances in membrane protein production platforms (e.g., Magic™ technology) aim to address these limitations .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, kindly indicate your preference during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Please note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
F2R; BTHR12; PAR1; Proteinase-activated receptor 1; PAR-1; Thrombin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
42-425
Protein Length
Full Length of Mature Protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
F2R
Target Protein Sequence
SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKPLPAFISEDASGYLTSSWL TLFVPSVYTGVFVVSLPVNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISY YLSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASF TCLAIWALAIAGVVPLLLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFV PLIISTVCYVSIIRCLSSSTVANRSKKSRALFLSAAVFCIFIICFGPTNILLIAHYSFLS HTSTTEAAYFAYLLCVCVSSISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSSNSSG QLMASKMDTCSSNLNNSIYKKLLT
Uniprot No.

Target Background

Function
High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Proteinase-activated Receptor 1 (F2R) in Papio hamadryas, and how does it compare structurally to human PAR1?

Proteinase-activated Receptor 1 (F2R) in Papio hamadryas (Hamadryas baboon) is a G protein-coupled receptor belonging to the seven-transmembrane superfamily of cell-surface receptors . The Papio hamadryas PAR1 protein contains 425 amino acids with a molecular weight comparable to the human variant (65-70 kDa) . Structurally, the baboon PAR1 shares significant homology with human PAR1, particularly in the cytoplasmic tail region where they exhibit approximately 84% sequence identity . The extracellular domains and propeptide regions show moderate conservation at about 58% identity between human and non-human primate variants . Like its human counterpart, the baboon PAR1 is activated through proteolytic cleavage of its N-terminal propeptide in the extracellular domain, leading to the exposure of a tethered ligand sequence that binds intramolecularly to trigger transmembrane signaling .

What are the key functional domains of recombinant Papio hamadryas PAR1, and what role do they play in receptor activation?

Recombinant Papio hamadryas PAR1 contains several critical functional domains essential for its activity:

  • N-terminal Extracellular Domain (aa 42-102): Contains the thrombin cleavage site that liberates the tethered ligand sequence necessary for receptor activation .

  • Seven Transmembrane Domains: Form the core structure of the receptor and participate in conformational changes during activation .

  • Intracellular Loops: Mediate interactions with signaling partners, particularly G proteins and β-arrestins .

  • C-terminal Cytoplasmic Tail (aa 375-425): Crucial for receptor desensitization, internalization, and scaffold protein recruitment .

The activation mechanism involves proteolytic cleavage by thrombin or other serine proteases at the receptor's N-terminus, revealing a tethered ligand sequence that binds intramolecularly to trigger conformational changes and initiate downstream signaling cascades . In the recombinant Papio hamadryas PAR1, the expression region typically encompasses amino acids 42-425, which includes all functional domains except the signal peptide .

What are the optimal conditions for expressing and purifying recombinant Papio hamadryas PAR1 for structural studies?

Expression and purification of recombinant Papio hamadryas PAR1 for structural studies requires careful optimization of several parameters:

Expression System Selection:

  • Bacterial Expression: While economical, bacterial systems like E. coli are typically suboptimal for full-length PAR1 due to the receptor's complex membrane topology and post-translational modifications .

  • Mammalian Expression Systems: HEK293 or CHO cells provide more appropriate cellular machinery for proper folding and post-translational modifications of the receptor.

Purification Strategy:

  • Affinity Tags: The recombinant protein can be engineered with affinity tags (determined during production) to facilitate purification .

  • Detergent Selection: Critical for maintaining receptor stability during extraction from membranes; typically, mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LMNG (lauryl maltose neopentyl glycol) are preferred.

  • Buffer Composition: Tris-based buffers with 50% glycerol have been successfully used for PAR1 storage .

Storage Conditions:

  • Store at -20°C for short-term use or -80°C for extended storage .

  • Avoid repeated freeze-thaw cycles, as they can compromise receptor integrity .

  • Working aliquots can be maintained at 4°C for up to one week .

How can researchers effectively design experiments to study PAR1 signaling pathways in endothelial models using recombinant Papio hamadryas PAR1?

Designing experiments to study PAR1 signaling in endothelial models requires a multi-faceted approach:

Receptor Expression Verification:

  • Western Blotting: Use PAR1-specific antibodies to confirm expression levels .

  • Flow Cytometry: Quantify surface expression of recombinant PAR1.

Functional Assays:

  • RhoA and Rac1 Activity Assays: These can be performed using GST-rhotekin Rho-binding domain (RBD) and p21-activated kinase (PAK-1)-binding domain (PBD) fusion proteins, respectively .

    Protocol Outline:

    • Culture endothelial cells (e.g., EA.hy926) in appropriate media

    • Serum-starve cells overnight

    • Treat with agonists (e.g., thrombin, APC) at 37°C

    • Lyse cells in buffer containing 50 mM Tris-HCl (pH 7.4), 100 mM NaCl, 2 mM MgCl₂, 1% Triton X-100, 10% glycerol with 1 mM DTT and protease inhibitors

    • Conduct pull-down assays with GST fusion proteins

    • Analyze by SDS-PAGE and immunoblotting

  • Endothelial Barrier Permeability Assay: Quantify flux of Evans blue-bound BSA to assess barrier function .

  • Immunoprecipitation Assays: To study protein-protein interactions:

    • Plate endothelial cells at 2 × 10⁶ cells per well

    • Serum-starve and treat with agonists

    • Lyse in appropriate buffer

    • Immunoprecipitate PAR1 using specific antibodies

    • Analyze by SDS-PAGE and immunoblotting

Signaling Pathway Analysis:

  • Use specific inhibitors of β-arrestin, Dvl-2, or G-protein pathways to dissect contribution of each to PAR1 signaling

  • Employ siRNA knockdown approaches to validate key signaling components

How do the signaling properties of Papio hamadryas PAR1 compare with human PAR1, and what are the implications for using baboon models in translational research?

The signaling properties of Papio hamadryas PAR1 share significant similarities with human PAR1, making baboon models valuable for translational research:

Similarities:

  • Activation Mechanism: Both human and baboon PAR1 are activated through proteolytic cleavage by thrombin and other serine proteases .

  • Signaling Pathways: Both receptors couple to similar G-protein subtypes (Gα₁₂/₁₃, Gαq) and interact with β-arrestins to mediate downstream signaling .

  • Physiological Roles: Both are implicated in inflammatory responses and vascular function .

Key Differences:

  • Sequence Variation: The 58% identity in extracellular domains may result in subtle differences in ligand recognition and binding affinity .

  • Species-Specific Regulation: Potential differences in receptor expression patterns and regulatory mechanisms.

Implications for Translational Research:

  • Model Selection: Baboon models represent a valuable intermediate between rodent models and human clinical studies due to their evolutionary proximity to humans.

  • Experimental Design Considerations: Researchers should account for the 16% sequence difference in the cytoplasmic tail when studying intracellular signaling events .

  • Pharmacological Relevance: Drugs targeting PAR1 may exhibit similar but not identical pharmacokinetic and pharmacodynamic profiles between species.

What evolutionary insights can be gained from studying PAR1 across different Papio species, including Papio hamadryas?

Studying PAR1 across Papio species provides valuable evolutionary insights:

  • Adaptive Evolution: The genus Papio exhibits remarkable behavioral and physiological flexibility in response to local conditions . This adaptability may extend to PAR1 function, potentially showing adaptive variations in receptor activity across different baboon populations inhabiting diverse ecological niches.

  • Genotype-Phenotype Correlations: In hybrid baboon populations, such as those in the Awash National Park, individuals with different morphological phenotypes (more hamadryas-like or more olive-like) exhibit corresponding behavioral differences . PAR1 variations might similarly correlate with phenotypic differences in inflammatory responses or vascular physiology.

  • Conservation of Critical Domains: Comparative analysis reveals which receptor domains are under strong evolutionary constraint, indicating functionally critical regions. The higher conservation in the cytoplasmic tail (84% identity) compared to the extracellular domains (58%) suggests stronger evolutionary pressure on intracellular signaling components .

  • Speciation Mechanisms: Studying PAR1 across closely related Papio species (P. hamadryas, P. anubis, P. ursinus) can illuminate how molecular evolution of GPCRs contributes to species divergence and adaptation to different ecological pressures .

How does the compartmentalization of PAR1 in caveolar microdomains affect its signaling properties, and what techniques can be used to study this phenomenon?

PAR1 compartmentalization in caveolar microdomains significantly impacts its signaling properties, particularly for cytoprotective pathways:

Key Effects of Caveolar Compartmentalization:

  • Selective Signaling Pathway Activation: PAR1 located in caveolae preferentially couples to cytoprotective signaling pathways when activated by APC, while PAR1 outside caveolae primarily mediates thrombin-induced barrier-disruptive signaling .

  • Scaffold Protein Assembly: Caveolar PAR1 exists in preassembled complexes with β-arrestins, facilitating rapid recruitment of signaling effectors like Dvl-2 .

  • G-Protein Coupling Specificity: Caveolar localization appears to favor β-arrestin-dependent signaling over heterotrimeric G-protein pathways .

Techniques to Study Caveolar Compartmentalization:

  • Density Gradient Fractionation:

    • Homogenize cells in detergent-free buffer

    • Separate membrane fractions on sucrose or OptiPrep gradients

    • Identify caveolar fractions by immunoblotting for caveolin-1

    • Assess PAR1 distribution across fractions

  • Immunofluorescence Microscopy:

    • Co-staining for PAR1 and caveolin-1

    • Super-resolution techniques (STORM, PALM) for precise co-localization analysis

  • Proximity Ligation Assay (PLA):

    • Detect in situ interactions between PAR1 and caveolar components

    • Quantify interaction dynamics following different agonist stimulations

  • Caveolar Disruption:

    • Cholesterol depletion using methyl-β-cyclodextrin

    • Caveolin-1 siRNA knockdown

    • Assessment of PAR1 signaling pathway alterations following disruption

What is the role of β-arrestin and Dvl-2 scaffolds in APC-activated PAR1 cytoprotective signaling, and how can researchers experimentally distinguish between G-protein dependent and β-arrestin dependent pathways?

β-arrestin and Dvl-2 scaffolds play critical roles in mediating APC-activated PAR1 cytoprotective signaling:

Functional Roles:

  • Preassembly with PAR1: In endothelial cells, PAR1 and β-arrestins exist in preassembled complexes within caveolar microdomains .

  • Signal Transduction: β-arrestins function as scaffolds that recruit Dvl-2 upon APC activation of PAR1 .

  • Rac1 Activation: The β-arrestin-Dvl-2 complex mediates Rac1 activation, which is critical for endothelial barrier protection .

  • Pathway Specificity: The β-arrestin-Dvl-2 pathway is specific for APC-induced cytoprotective signaling and is not involved in thrombin-stimulated RhoA signaling and barrier disruption .

Experimental Approaches to Distinguish Pathway Dependencies:

  • siRNA Knockdown Studies:

    • Target β-arrestins (1 and 2) and Dvl-2 independently

    • Assess effects on downstream signaling (Rac1 vs. RhoA activation)

    • Measure functional outcomes (barrier protection vs. disruption)

    Key finding: Depletion of β-arrestin expression results in loss of APC-induced Rac1 activation but does not affect thrombin-stimulated RhoA signaling .

  • Pharmacological Inhibition:

    • G-protein inhibition using pertussis toxin (for Gαi)

    • Small molecule inhibitors of β-arrestin-receptor interactions

  • Co-immunoprecipitation Assays:

    • Immunoprecipitate PAR1 following agonist stimulation

    • Probe for associated proteins (G-proteins vs. β-arrestins and Dvl-2)

    • Compare protein associations following APC vs. thrombin stimulation

  • Functional Readouts:

    • Endothelial barrier permeability assays using Evans blue-bound BSA

    • RhoA and Rac1 activity assays using GST-fusion protein pull-downs

    • Analysis of adherens junction assembly/disassembly

How can recombinant Papio hamadryas PAR1 be utilized to develop selective modulators that target specific PAR1 signaling pathways?

Recombinant Papio hamadryas PAR1 provides a valuable tool for developing pathway-selective modulators:

Structure-Based Drug Design Approaches:

  • Comparative Structural Analysis: Leveraging the high homology between human and baboon PAR1 (particularly the 84% identity in the cytoplasmic tail) to identify conserved binding pockets for drug targeting .

  • Biased Ligand Development: Designing compounds that selectively activate cytoprotective β-arrestin-dependent pathways without triggering detrimental G-protein signaling .

  • Allosteric Modulator Screening: Utilizing recombinant Papio hamadryas PAR1 in high-throughput screening assays to identify compounds that bind to allosteric sites and selectively modulate specific signaling pathways.

Experimental Validation Platforms:

  • Parallel Signaling Assays: Developing assay systems that simultaneously monitor multiple signaling outputs (G-protein vs. β-arrestin pathways) to identify biased PAR1 modulators .

  • Domain-Specific Mutations: Creating targeted mutations in key domains of recombinant PAR1 to map critical regions for pathway-selective signaling.

  • Cross-Species Validation: Testing compound efficacy across PAR1 from different species to ensure target engagement is maintained in translational models.

What are the current methodological challenges in studying PAR1 compartmentalization, and how might these be overcome using recombinant Papio hamadryas PAR1?

Studying PAR1 compartmentalization presents several methodological challenges that can be addressed using recombinant Papio hamadryas PAR1:

Current Challenges:

  • Maintaining Receptor Integrity: G-protein coupled receptors are notoriously difficult to study due to their complex membrane topology and instability when removed from their native environment .

  • Visualizing Dynamic Compartmentalization: Traditional imaging approaches lack the temporal and spatial resolution to capture rapid receptor movements between membrane microdomains.

  • Functional Relevance Assessment: Correlating compartmentalization with specific signaling outcomes remains technically challenging.

Innovative Solutions Using Recombinant Papio hamadryas PAR1:

  • Engineered Tagging Strategies:

    • Site-specific incorporation of minimally disruptive tags (e.g., FlAsH/TetraCys, SNAP-tag)

    • Strategic placement to avoid interference with critical domains

    • Enables live-cell imaging of receptor dynamics

  • Reconstituted Membrane Systems:

    • Incorporating purified recombinant PAR1 into artificial membrane systems with defined lipid compositions

    • Creating synthetic caveolae-like domains to study compartmentalization in a controlled environment

    • Testing how lipid environment influences receptor conformation and signaling

  • Domain Swapping Experiments:

    • Creating chimeric receptors between human and baboon PAR1

    • Identifying domains responsible for compartmentalization and signaling specificity

    • Leveraging the 16% sequence difference in cytoplasmic tails to identify key regulatory regions

  • Advanced Imaging Approaches:

    • Single-molecule tracking of labeled recombinant PAR1

    • Super-resolution microscopy to visualize nanoscale distribution

    • Fluorescence correlation spectroscopy to measure diffusion dynamics in different membrane domains

What are the common pitfalls in experimental design when working with recombinant Papio hamadryas PAR1, and how can researchers address them?

Researchers working with recombinant Papio hamadryas PAR1 should be aware of several common experimental pitfalls:

Receptor Stability and Storage:

  • Protein Degradation: PAR1 is susceptible to proteolytic degradation during storage and handling .

    • Solution: Use optimized storage buffers (Tris-based buffer with 50% glycerol) and include protease inhibitors during all experimental procedures .

    • Quality Control: Regularly verify receptor integrity by SDS-PAGE and western blotting before experiments.

  • Activity Loss: Repeated freeze-thaw cycles significantly reduce receptor functionality .

    • Solution: Store as single-use aliquots at -80°C for long-term storage and maintain working aliquots at 4°C for up to one week .

Experimental Design Considerations:

  • Protease Contamination: Unintended receptor activation by proteases present in culture media or serum.

    • Solution: Use serum-free conditions during critical experiments and include appropriate protease inhibitors that don't affect the intended proteolytic activation.

  • Species Cross-Reactivity Issues: Antibodies or ligands designed for human PAR1 may have different affinities for baboon PAR1.

    • Solution: Validate all reagents specifically with recombinant Papio hamadryas PAR1 before conducting major experiments.

    • Control: Include side-by-side comparisons with human PAR1 when possible.

How can researchers effectively quantify and compare the activation of different signaling pathways downstream of Papio hamadryas PAR1?

Effective quantification of different signaling pathways downstream of PAR1 requires a comprehensive experimental approach:

Pathway-Specific Activity Assays:

  • G-Protein Pathway Quantification:

    • RhoA Activation: GST-rhotekin RBD pull-down assays followed by immunoblotting .

    • Second Messenger Measurement: Calcium mobilization assays using fluorescent indicators (Fura-2, Fluo-4).

    • Phosphorylation Cascades: Phospho-specific antibodies against ERK1/2, p38 MAPK, or other downstream kinases.

  • β-Arrestin Pathway Quantification:

    • Recruitment Assays: BRET or FRET-based assays measuring β-arrestin recruitment to PAR1.

    • Rac1 Activation: GST-PAK-PBD pull-down assays and immunoblotting .

    • Dvl-2 Association: Co-immunoprecipitation of PAR1 with Dvl-2 following agonist stimulation .

Comparative Analysis Framework:

  • Dose-Response Relationships: Generate complete dose-response curves for multiple pathways with the same agonist.

  • Temporal Dynamics: Measure activation kinetics with high temporal resolution to detect pathway-specific activation patterns.

  • Quantitative Normalization: Use internal controls for each pathway and normalize data to maximum response for fair comparison between pathways.

Data Representation:

Signaling PathwayAssay MethodDetection RangeTemporal ResolutionKey Controls
G-Protein (RhoA)GST-rhotekin pull-down2-30 min post-stimulation2-5 min intervalsTotal RhoA levels
β-ArrestinCo-immunoprecipitation1-20 min post-stimulation1-2 min intervalsTotal β-arrestin expression
Rac1 ActivationGST-PAK-PBD pull-down2-30 min post-stimulation2-5 min intervalsTotal Rac1 levels
Dvl-2 RecruitmentCo-immunoprecipitation2-15 min post-stimulation2-5 min intervalsTotal Dvl-2 expression

By implementing these methodological approaches, researchers can effectively quantify and compare different signaling pathways downstream of Papio hamadryas PAR1, enabling more comprehensive understanding of receptor function and signaling bias.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.