Recombinant Papio hamadryas Taste receptor type 2 member 10 (TAS2R10)

Shipped with Ice Packs
In Stock

Description

Introduction to TAS2R10

TAS2R10 belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia . They play a crucial role in detecting bitter compounds in food and the environment, serving as an evolutionary warning system against potentially toxic substances. The gene encoding TAS2R10 is organized in the genome in clusters and is genetically linked to loci that influence bitter perception in both mice and humans .

In humans, TAS2R10 maps to the taste receptor gene cluster on chromosome 12p13 . The gene is also known by several synonyms, including T2R10, TRB2, MGC126811, MGC126813, and taste receptor family B member 2, reflecting its classification within broader taste receptor families and its identification through various research initiatives .

The recombinant form of Papio hamadryas TAS2R10 represents the artificially produced version of this protein, typically expressed in laboratory systems for research purposes. This recombinant protein maintains the functional characteristics of the native protein while offering advantages in terms of purity, consistency, and experimental utility.

Agonist Binding Site

Extensive research has been conducted to identify the structural basis for TAS2R10's ligand recognition and activation. Through in silico modeling, point mutagenesis, and functional assays, researchers have located the presumed agonist binding site of this receptor . This binding pocket is situated between the upper parts of transmembrane domains III to VII within the receptor structure .

Using energy-based computational methods, researchers have characterized this binding pocket as an appropriately sized and energetically favorable area inside the transmembrane bundle that can accommodate various TAS2R10 agonists . To verify the location of this predicted agonist binding pocket, residues whose side-chains point into the central cavity have been subjected to alanine-scanning mutagenesis .

Receptor Activation and Ligand Specificity

TAS2R10 exhibits an exceptionally broad tuning, responding to a diverse range of bitter compounds despite their structural differences . Notable agonists include strychnine, parthenolide, and denatonium benzoate, all of which can activate both TAS2R10 and its related receptor TAS2R46 .

Interestingly, despite sharing only 34% amino acid sequence identity with TAS2R46, TAS2R10 shows overlapping agonist activation patterns . This similarity may result from either:

  1. The extraordinarily broad tuning of both receptors, allowing for recognition of similar compounds on a seemingly random basis

  2. Evolutionary conservation, suggesting both receptors might have originated from the same ancestral TAS2R gene and preserved aspects of its agonist profile

Specific mutations such as TAS2R10-M263E and TAS2R10-T266A have been studied to determine their effects on receptor function, providing valuable insights into the molecular mechanisms underlying bitter taste perception . The primers used for generating these mutations include:

  • TAS2R10-M263E Forward: CTTATGTTTGGAGAGACAACCACAGCC

  • TAS2R10-M263E Reverse: GGCTGTGGTTGTCTCTCCAAACATAAG

  • TAS2R10-T266A Forward: GTTTGGAATGACAACCGCAGCCATCTATCCCTG

  • TAS2R10-T266A Reverse: CAGGGATAGATGGCTGCGGTTGTCATTCCAAAC

TAS2R Gene Evolution in Primates

The evolution of TAS2R genes, including TAS2R10, provides valuable insights into dietary adaptations across primate species. Research suggests that diet is a significant driver of primate Tas2r evolution, with certain species developing specific Tas2r gene duplications during their evolutionary history .

Phylogenetic analyses have classified primate TAS2R genes into 21 distinct clades, revealing patterns of gene duplication and loss across different lineages . Some clades contain genes specific to particular taxonomic groups, such as anthropoid-specific genes in clade 9 and Strepsirrhini-specific genes in clade 5 .

Gene Duplication Patterns

An important aspect of TAS2R evolution is the variation in gene copy number across primate species. While many species maintain single copies of specific TAS2R genes, others have developed multiple copies, suggesting differential needs for detecting particular bitter substances .

For instance, several Old World monkeys (Cercopithecidae), including Papio anubis (olive baboon) and Cercocebus atys, possess two copies of certain TAS2R genes . This pattern of gene duplication likely reflects adaptations to different dietary niches and the need to detect potentially toxic plant compounds. Cercocebus atys has been found to possess three copies of TAS2R in certain gene groups, indicating an even greater selective pressure for bitter compound detection in this species .

Genomic Organization

TAS2R genes are typically arranged in tandem duplications and concentrated on the same genomic scaffolds . In many primates, approximately half of the total TAS2R genes are located on just two to four scaffolds, demonstrating their clustered genomic organization .

Several primate species have a large number of TAS2R genes on individual scaffolds. For example, olive baboon (Papio anubis), which is closely related to the hamadryas baboon (Papio hamadryas), contains more than 20 TAS2R genes on a single scaffold . This clustered arrangement facilitates evolutionary processes such as gene duplication and conversion, contributing to the diversification of taste receptor genes in response to environmental and dietary pressures.

Research Applications

The recombinant Papio hamadryas TAS2R10 protein serves numerous research applications in fields ranging from basic taste perception studies to pharmaceutical development:

  1. Structural and functional studies: Investigating the relationship between receptor structure and ligand recognition through techniques such as site-directed mutagenesis and functional assays

  2. Comparative genomics: Comparing TAS2R10 from different primate species to understand evolutionary adaptations in taste perception related to dietary specialization

  3. Ligand screening: Identifying novel compounds that interact with TAS2R10, useful for developing taste modifiers or bitter blockers

  4. Drug development: Exploring the potential role of taste receptors in extraoral tissues and their possible involvement in physiological processes beyond taste perception

Receptor Modeling and Structure Determination

Significant advances have been made in understanding the three-dimensional structure of TAS2R10 through homology modeling. Based on the crystal structure of the β2 adrenergic receptor-Gs-protein complex with bound agonist (PDB code 3SN6), researchers have generated comprehensive models of TAS2R10 .

The sequence alignment between TAS2R10 and the structural template was initially generated using the Expresso server and subsequently refined through manual adjustments . The resulting 3D model was further processed using various computational techniques:

  1. Energy minimization using the Smart Minimizer algorithm

  2. Application of the CHARMM force field as implemented in Discovery Studio 3.1

  3. Side-chain refinement using the SCWRL4 program

  4. Additional rounds of energy minimization to achieve a stable conformation

These sophisticated modeling approaches have provided valuable insights into the structural basis of TAS2R10 function, particularly regarding the spatial arrangement of its transmembrane domains and the configuration of its agonist binding pocket.

Comparative Studies with Human TAS2R10

Comparative analyses between TAS2R10 from different primate species, including humans, have revealed interesting patterns of conservation and divergence. These studies contribute to our understanding of the evolutionary pressures that have shaped bitter taste perception across the primate lineage.

The human TAS2R10 has been particularly well-studied regarding its interaction with bitter compounds. Research has shown that it is tailored to accommodate specific agonists within its binding pocket . By comparing the human receptor with its counterparts in other primates, including Papio hamadryas, researchers can identify conserved regions that are likely critical for core receptor function, as well as variable regions that may reflect species-specific adaptations to different dietary environments.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is dependent on various factors such as storage state, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R10; Taste receptor type 2 member 10; T2R10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MLSVVEGILILVVISESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWI IITDGFIQIFSPDVYASGNLIEYISYFWVITNQSSIWFATSLSIFYFLKIANFSNYIFLW LKSRINRVLPLLMGFLLISCLLNFAYIVKILNDLKMKNDTVWRLNMYKSEYFIKQLLLNL GVIFFFTLSLITSVLLIISLWRHNRQMQSNVTGLRDSITEAHVKAMKVLISFIILFILYF IGIAIEISYFTVPENKLLLIFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEE RKNLRAT
Uniprot No.

Target Background

Function
This receptor, potentially involved in bitterness perception, is linked to gustducin. It may play a role in sensing the chemical composition of the gastrointestinal content. Activation of this receptor might stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to TRPM5 gating.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R10 and what is its primary biological role?

TAS2R10 belongs to the TAS2R family of G-protein-coupled bitter taste receptors that play a crucial role in bitter taste perception. The primary evolutionary function of these receptors is to enable organisms to detect and avoid potentially harmful toxic substances in food sources . In humans, TAS2R10 specifically responds to strychnine and numerous other bitter compounds with a broad tuning profile . This receptor is part of a larger bitter taste receptor gene family that has evolved differently across primate species, reflecting adaptations to various ecological niches and dietary patterns .

How does the TAS2R10 structure relate to its function?

TAS2R10 functions as a G-protein-coupled receptor with multiple transmembrane domains. Comparative modeling studies have identified specific residues involved in agonist-induced activation, particularly S85(3.29) and Q175(5.40), which have differential impacts on stimulation with different agonists . The receptor possesses extracellular, transmembrane, and intracellular domains that can be identified through Kyte-Doolittle hydrophobicity plots . The binding site of TAS2R10 has evolved to optimally accommodate multiple agonists, though this comes at the expense of reduced potency for individual compounds . This structural flexibility explains how a single receptor can detect multiple bitter compounds while maintaining specificity.

What genomic techniques are used to study TAS2R10 in primates?

Several complementary genomic approaches have been employed to study TAS2R10 and other taste receptors in primates:

  • Targeted Capture (TC) followed by short-read and high-depth massive-parallel sequencing has been used to specifically probe TAS2R genes in primates, providing more complete data than whole-genome assembly (WGA) databases .

  • CRISPR/Cas9 gene-editing techniques have been employed to create knockout animal models for functional studies of taste receptor clusters .

  • Comparative genomic analysis using software such as PAML (Phylogenetic Analysis by Maximum Likelihood) to estimate dN/dS ratios and identify evolutionary selection pressures .

  • Quantitative RT-PCR for assessing expression profiles of TAS2R genes in taste buds and other tissues .

  • Co-expression analysis using large datasets (e.g., 60,000 Affymetrix expression arrays and 5,000 TCGA datasets) to uncover functional relationships .

These methods collectively provide researchers with tools to investigate the genetic structure, evolutionary history, and functional significance of TAS2R10 across primate species.

How has TAS2R10 evolved across primate lineages?

The evolution of TAS2R10 and other bitter taste receptors in primates shows distinct patterns corresponding to dietary adaptations. Evolutionary analysis reveals that TAS2R genes have undergone both expansion and contraction events throughout primate evolution . In Cercopithecidae (Old World monkeys), specific TAS2R duplications have occurred during evolution, suggesting adaptive responses to dietary changes .

When comparing different primate subfamilies, contrasting evolutionary trajectories are evident. For instance, between colobines and cercopithecines, the common ancestors showed opposite patterns with four gene "deaths" in colobines and three gene "births" in cercopithecines . The evolutionary rates of TAS2R genes can be quantified using dN/dS ratios, which measure the ratio of non-synonymous to synonymous substitutions to identify genes under positive selection .

These findings suggest that TAS2R10 evolution is driven by complex ecological factors rather than following a simple linear pattern based on dietary preferences.

What is the relationship between diet and TAS2R gene repertoire in primates?

The relationship between diet and TAS2R gene repertoire in primates presents an interesting paradox. Current research indicates:

  • Folivorous (leaf-eating) colobine species have a markedly reduced number of intact TAS2R genes (25-28 detected via targeted capture and 20-26 detected via whole-genome analysis) compared to omnivorous cercopithecines (27-36 via targeted capture and 19-30 via whole-genome analysis) .

  • This finding challenges the simple prediction that herbivorous primates would have more TAS2R genes than omnivorous species to detect a wider range of plant toxins .

  • Dietary adaptations in folivorous species, such as specialized digestive systems that allow them to tolerate certain toxic compounds, may reduce their need for extensive bitter taste detection capabilities .

  • The evolutionary changes in TAS2R genes show complex patterns with "birth" or "death" events occurring at almost every phylogenetic branch, making the composition of intact genes highly variable among species .

These findings suggest that the evolution of taste receptors is shaped by multiple factors beyond simple dietary categories, including specific plant secondary compounds encountered, detoxification abilities, and other ecological factors.

How do paralogs of TAS2R10 differ in their binding properties?

  • Engineering the key determinants for TAS2R46 activation by strychnine into TAS2R10 causes a loss of response to strychnine rather than enhancing it .

  • This suggests independent acquisition of agonist specificities following gene duplication events .

  • The independent evolution of strychnine-binding sites implies that the gene duplication event preceding primate speciation allowed for divergent optimization of receptor functions .

This binding diversity highlights an important principle in molecular evolution: after gene duplication, paralogs can evolve distinct ligand-binding mechanisms even when detecting the same compounds, allowing for fine-tuning of sensory capabilities in different ecological contexts.

What molecular techniques are effective for studying recombinant TAS2R10 function?

Several molecular techniques have proven effective for studying the function of recombinant TAS2R10:

  • Site-directed mutagenesis: This approach has been instrumental in identifying specific residues involved in agonist-induced activation of TAS2R10. By systematically substituting amino acids and testing functional changes, researchers have mapped critical regions for receptor activation .

  • Comparative modeling: Computational approaches have been used to predict the three-dimensional structure of TAS2R10 and identify potential binding sites, which can then be validated experimentally .

  • Functional assays: Cellular assays measuring intracellular calcium release or other second messengers can quantify receptor activation in response to various ligands. These assays have been used to characterize the differential effects of mutations on receptor responses to different agonists .

  • Two-bottle preference tests: When studying taste receptors in animal models, behavioral assays such as two-bottle preference tests provide functional data on taste perception alterations resulting from receptor modifications .

  • Immunostaining: This technique allows visualization of receptor expression in taste buds and other tissues, providing insights into receptor localization and potential extraoral functions .

These complementary approaches provide researchers with tools to comprehensively characterize TAS2R10 function from molecular interactions to behavioral outcomes.

What are the extraoral functions of TAS2R10 beyond taste perception?

Recent research has revealed that TAS2R10, like other bitter taste receptors, is expressed in multiple extraoral tissues and may serve functions beyond taste perception. Bioinformatics analysis using co-expression data has identified several potential biological roles for TAS2R10:

  • Cellular protein processes: TAS2R10 appears to be involved in cellular protein metabolic processes, protein modification processes, and cellular component assembly .

  • Subcellular localization: The co-expressed genes accumulate in specific cellular components, including "Spt-Ada-Gcn5 acetyltransferase (SAGA)-type complex" and "SAGA complex" .

  • Enzymatic functions: TAS2R10 may be associated with molecular functions such as hexosaminidase activity, cytoskeletal adaptor activity, cyclin binding, and β-N-acetylhexosaminidase activity .

  • Ubiquitin-mediated proteolysis: One of the most significant findings suggests TAS2R10 involvement in ubiquitin-mediated proteolysis pathways, potentially linking bitter taste receptors to protein degradation systems .

  • Disease associations: TAS2R10 has been linked to certain pathological conditions, including Salmonella infection, suggesting potential roles in immune function .

These extraoral functions suggest that bitter taste receptors have been repurposed throughout evolution to serve diverse physiological roles beyond their original sensory function, making them interesting targets for multidisciplinary research.

How can knockout models advance our understanding of TAS2R10 function?

Knockout models provide powerful tools for understanding TAS2R10 function in vivo. Research using CRISPR/Cas9-generated taste receptor mutant mice has yielded significant insights that can inform studies of Papio hamadryas TAS2R10:

  • Specificity profiling: Knockout models allow researchers to determine which bitter compounds are specifically detected by individual or clustered taste receptors. For example, mice with mutations in the Tas2r104/Tas2r105/Tas2r114 cluster showed loss of taste perception to specific compounds including quinine, denatonium benzoate, and cucurbitacin B .

  • Expression changes: qRT-PCR analysis of knockout models has revealed that mutation of specific TAS2R genes can alter the expression profile of other taste receptor genes, suggesting compensatory mechanisms .

  • Signaling pathway elucidation: By knocking out both receptor genes and associated signaling components (e.g., GNAT3), researchers can dissect the contribution of specific signaling pathways to bitter compound perception .

  • Extraoral function investigation: Knockout models facilitate the study of taste receptor functions in extraoral tissues, where their roles remain largely unexplored .

  • Behavioral validation: Two-bottle preference tests with knockout mice provide behavioral validation of molecular findings, connecting genetic modifications to actual taste perception .

When designing knockout studies for Papio hamadryas TAS2R10, researchers should consider these precedents while accounting for species-specific differences in receptor distribution and function.

What computational approaches can predict novel functions of TAS2R10?

Advanced computational approaches offer powerful methods to predict novel functions of TAS2R10 beyond its known role in bitter taste perception:

  • Co-expression network analysis: By analyzing data from large expression datasets (e.g., 60,000 Affymetrix arrays and 5,000 TCGA datasets), researchers can identify genes whose expression patterns correlate with TAS2R10, suggesting functional relationships .

  • Functional enrichment analysis: Gene Ontology (GO) and KEGG pathway analyses of co-expressed genes can reveal biological processes, cellular components, and molecular functions associated with TAS2R10 .

  • Statistical validation: Multiple testing corrections (e.g., using q-values) ensure that predicted functional associations are statistically significant. Genes with q-values <0.05 can be considered significantly co-expressed with TAS2R10 .

  • Comparative genomics: Analyzing selective pressures (dN/dS ratios) across different domains of the receptor can identify functionally important regions under positive or purifying selection .

  • Protein domain analysis: Kyte-Doolittle plots and other methods to identify hydrophobic transmembrane domains can help predict protein structure and potential interaction sites .

These computational approaches, when combined with experimental validation, can significantly accelerate the discovery of novel TAS2R10 functions and guide more targeted laboratory investigations.

How do TAS2R gene duplications affect functional diversification?

TAS2R gene duplications represent a key mechanism for functional diversification in bitter taste perception across primate species. The research data reveals several important patterns:

  • Clade-specific expansions: Different clades of primates show specific patterns of TAS2R duplication. For example, some TAS2R genes are Strepsirrhini-specific while others are anthropoid-specific, suggesting unique selective pressures in these lineages .

  • Differential duplication rates: Some primate lineages show substantial gene gains, such as M. murinus and O. garnettii with five and six gene gains respectively, while others show gene losses .

  • Functional consequences: Gene duplication allows for subfunctionalization (division of ancestral functions among duplicates) or neofunctionalization (evolution of new functions in one copy). For example, paralogous receptors like TAS2R10 and TAS2R46 have evolved different binding modes for the same agonist, strychnine .

  • Taxonomic variation: Cercopithecidae species have developed specific TAS2R duplications during evolution, likely reflecting adaptations to their dietary niche .

  • Methodological considerations: The detection of gene duplications is highly dependent on sequencing methodology, with targeted capture approaches revealing more intact TAS2R genes than whole-genome analyses .

These patterns of duplication and functional divergence highlight the dynamic nature of bitter taste receptor evolution and suggest that Papio hamadryas TAS2R10 should be studied in the context of related paralogs to fully understand its functional significance.

What are the challenges in comparing TAS2R10 function across primate species?

Comparing TAS2R10 function across primate species presents several methodological and conceptual challenges that researchers should address:

  • Sequence completeness: Whole-genome assembly data are often incomplete for multigene families like TAS2Rs. Targeted capture approaches yield more complete data but require careful probe design to capture all variants .

  • Functional equivalence: Even when orthologous genes are identified, they may have evolved different functional properties. Single point mutations can improve responses to some agonists while decreasing activation by others .

  • Expression differences: TAS2R10 may be expressed in different tissues or at different levels across primate species, affecting its functional significance .

  • Ecological context: Interpreting functional differences requires consideration of species-specific ecological factors, including diet, habitat, and detoxification abilities .

  • Signaling pathway variation: Downstream signaling components may differ across species, affecting how receptor activation translates to physiological responses .

  • Compensatory mechanisms: Loss or modification of one receptor may be compensated by changes in other receptors or pathways, complicating cross-species comparisons .

To overcome these challenges, researchers studying Papio hamadryas TAS2R10 should employ multiple complementary approaches, including genomic, functional, and ecological analyses, while being cautious about extrapolating findings across species.

What are the most promising research directions for Papio hamadryas TAS2R10?

Based on current knowledge gaps and emerging findings, several research directions appear particularly promising for advancing our understanding of Papio hamadryas TAS2R10:

  • Comparative functional analysis: Directly comparing the ligand response profiles of recombinant P. hamadryas TAS2R10 with human and other primate orthologs could reveal species-specific adaptations in bitter compound detection.

  • Extraoral expression mapping: Comprehensive mapping of TAS2R10 expression in non-gustatory tissues of P. hamadryas could identify novel physiological roles beyond taste perception.

  • Diet-receptor co-evolution: Analyzing the relationship between P. hamadryas' natural diet and TAS2R10 properties could clarify how ecological factors shape taste receptor evolution.

  • Signaling pathway characterization: Identifying species-specific differences in TAS2R10 signaling cascades could reveal functional adaptations in downstream response mechanisms.

  • Structure-function relationships: Detailed analysis of the structural determinants of ligand binding in P. hamadryas TAS2R10 could advance our understanding of how evolutionary changes affect receptor function.

These research directions, pursued with rigorous methodology and attention to evolutionary context, promise to yield significant insights into the biology of bitter taste reception in primates and its broader physiological implications.

How can TAS2R10 research inform broader questions in evolutionary biology?

Research on Papio hamadryas TAS2R10 has implications that extend beyond taste perception to address fundamental questions in evolutionary biology:

  • Gene family evolution: The patterns of duplication, loss, and functional divergence observed in TAS2R genes provide a model system for understanding how multigene families evolve in response to environmental challenges .

  • Sensory ecology: Comparing TAS2R10 function across species with different diets can illuminate how sensory systems adapt to ecological niches and how these adaptations influence feeding behavior .

  • Molecular adaptation: The observation that single point mutations in TAS2R10 can differentially affect responses to various ligands illustrates the molecular basis of functional evolution and the trade-offs involved in receptor tuning .

  • Co-evolution with dietary toxins: TAS2R10 research can provide insights into the evolutionary arms race between plant defense compounds and animal detoxification mechanisms .

  • Functional repurposing: The discovery of extraoral functions for TAS2R10 exemplifies how proteins can be repurposed for new functions throughout evolution, a fundamental principle in evolutionary developmental biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.