Recombinant Papio hamadryas Taste receptor type 2 member 14 (TAS2R14)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

TAS2R14 is a class A GPCR expressed in taste receptor cells and extraoral tissues such as the cerebellum, pancreas, and immune cells . The recombinant version is produced using heterologous expression systems to study its ligand interactions, signaling mechanisms, and therapeutic potential . Unlike human TAS2R14, the baboon ortholog shares structural homology but may exhibit species-specific ligand affinities .

Core Architecture

  • Binding Pockets: TAS2R14 features a flexible binding pocket that accommodates structurally diverse agonists, including flufenamic acid (FFA) and cholesterol. Cryo-EM studies reveal a dual-binding mechanism: one ligand occupies the canonical orthosteric site, while another binds intracellularly near the G-protein interface .

  • Key Residues: Critical interactions involve residues such as W89³.³², F247⁶.⁵⁵, and H94³.³⁷, which stabilize ligand binding through π-π stacking, hydrogen bonds, and salt bridges .

Dynamic Activation

  • Molecular dynamics simulations show that agonist binding disrupts a transmembrane H-bond (TMD3), enabling receptor activation and coupling to gustducin (Gα) .

  • Cholesterol acts as a semi-activating ligand by occupying the orthosteric site, priming TAS2R14 for efficient agonist response .

Ligand Diversity

TAS2R14 is exceptionally promiscuous, responding to >150 agonists, including:

  • Bitter tastants: Flufenamic acid, papaverine .

  • Endogenous metabolites: Cholesterol, bile acids .

Signaling Pathways

  • Taste Transduction: Agonist binding activates gustducin, triggering Ca²⁺ release and downstream signaling in taste cells .

  • Extraoral Roles: In airway smooth muscle, TAS2R14 activation induces bronchodilation via potassium channel hyperpolarization .

Respiratory Diseases

TAS2R14 agonists like FFA show potential for treating asthma and COPD by relaxing airway smooth muscle .

Cancer Research

  • Overexpression of TAS2R14 correlates with improved survival in pancreatic adenocarcinoma and induces apoptosis in cancer cell lines .

  • Its role as a metabolite sensor (e.g., cholesterol binding) suggests utility in targeting metabolic disorders .

Research Tools and Limitations

  • Experimental Challenges: Low natural abundance and structural flexibility complicate crystallization .

  • Probes: Fluorescent derivatives (e.g., TAMRA-labeled TP46) enable binding studies via BRET assays .

Future Directions

  • Drug Design: Exploiting the intracellular allosteric site for selective modulator development .

  • Mechanistic Studies: Clarifying the role of bile acids and cholesterol in receptor priming .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice packaging is required, please notify us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a particular tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R14; Taste receptor type 2 member 14; T2R14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MDGVIKSIFTFILILEFIIGNLGNSFIVLVNCIDWVKRRKISLVDQLLIALAISRISLVW SIFGSWCVSVVFPALFATEKLLRMLTNIWTVTNHFSVWLATILGTFYFLKIANFSNSIFL YLKWRVKKVVLVLLLVTLVLLFLNILLINIHINASINGYRGNMTCSSASCNFIRFSSAIA LTSTVFILIPFTLSLATFLLLSFSLWKHRKKMQHTVKGYRDVSTKAHRGVMQTVITFLLL YAVFFLTFFVSIWISERLKENQIIILSEMMGLAYPSGHSCVLILGNKKLRQASLSVLWWL RYRFKDGELSGHKEFRESS
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is linked to gustducin. It may also be involved in sensing the chemical composition of the gastrointestinal content. The receptor's activity may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular characterization of Papio hamadryas TAS2R14?

Papio hamadryas TAS2R14 belongs to the bitter taste receptor family, which functions as G-protein-coupled receptors. These receptors are specifically expressed in taste receptor cells of the tongue and palate epithelia, though they also appear in various extra-oral tissues. They are genetically linked to loci that influence bitter perception in mammals . The receptor is organized in the genome in clusters, similar to human TAS2R14, which is located on chromosome 12p13 .

Molecular studies show that TAS2R14 from Papio hamadryas shares significant sequence homology with human TAS2R14, making it a valuable comparative model for research. Like other bitter taste receptors, its structure includes seven transmembrane domains characteristic of GPCRs, with binding pockets that accommodate a wide range of bitter compounds and microbial signals.

How do expression systems for recombinant Papio hamadryas TAS2R14 compare in efficiency?

Several expression systems have been utilized for the production of recombinant TAS2R14, each with distinct advantages:

Expression SystemAdvantagesLimitationsYield Efficiency
E. coliCost-effective, high yieldLacks post-translational modifications, membrane protein folding challengesModerate
HEK293T cellsProper membrane trafficking, human-like post-translational modificationsHigher cost, lower yieldHigh functional protein
Insect cell linesGood for GPCR expression, proper foldingMore complex cultivation requirementsModerate to high

For functional studies of TAS2R14, mammalian cell expression systems like HEK293T cells are typically preferred as they provide the appropriate cellular machinery for receptor trafficking and signaling. Research shows that HEK293T cells overexpressing TAS2R14 demonstrate concentration-dependent calcium mobilization when treated with ligands such as bacterial quorum sensing molecule C12 and fungal quorum sensing molecules farnesol and tyrosol .

What assays are most reliable for evaluating Papio hamadryas TAS2R14 activation?

Several methodological approaches can effectively measure TAS2R14 activation:

  • Calcium mobilization assays: The most common approach utilizes fluorescent calcium indicators or bioluminescence-based systems to detect intracellular calcium release upon receptor activation. For example, when TAS2R14 is activated by ligands like diphenhydramine (DPH), a concentration-dependent intracellular calcium mobilization occurs .

  • cAMP accumulation assays: Since TAS2R14 couples to Gαi proteins, measurement of inhibition of adenylyl cyclase and reduction in cAMP levels can serve as an indicator of receptor activation .

  • NanoBRET assays: These assays can detect direct interaction between TAS2R14 and G proteins, as demonstrated by research showing specific and saturable association between TAS2R14 and Gαi .

  • Gene reporter assays: Systems using luciferase or other reporters downstream of TAS2R14 signaling pathways can provide quantifiable activation metrics over longer time periods.

Studies have shown that cell-based functional assays measuring events distal to receptor activation (changes in second messenger levels) are commonly used because they allow for amplification of the signal .

How can researchers effectively study TAS2R14-mediated immune responses in different cellular contexts?

TAS2R14 plays a significant role in innate immune responses, particularly in airway epithelial cells. To effectively study these responses, researchers should consider:

  • Cell model selection: Primary human bronchial epithelial (HBE) cells from both normal and disease states (e.g., cystic fibrosis) allow for comparative analysis of TAS2R14 function. Research shows significantly higher TAS2R14 mRNA expression in bronchial epithelial cells from cystic fibrosis patients (BCF) compared to non-CF donors (BD) .

  • Knockdown approach: shRNA-mediated knockdown of TAS2R14 is an effective method to query its involvement in immune responses. Studies have achieved approximately 70% reduction in T2R14 mRNA using lentivirus encoding T2R14-shRNA .

  • Air-liquid interface (ALI) cultures: For studying responses in a physiologically relevant system, ALI cultures of bronchial epithelial cells provide a differentiated airway epithelium model. These cultures have been used to demonstrate that treatment with quorum sensing molecules enhances the secretion of antimicrobial peptides like human beta-defensin 2 (hBD-2) .

  • Immune marker measurement: Quantification of specific immune markers such as nitric oxide production and antimicrobial peptide secretion provides insight into TAS2R14's role in host defense. Research indicates that TAS2R14 deficient CF cells display reduced total nitrate levels and reduced hBD-2 response .

  • Bacterial challenge experiments: Comparing responses to wild-type bacteria versus quorum sensing molecule-deficient strains can elucidate TAS2R14's specific role in detecting microbial signals. Studies with P. aeruginosa wild type versus QSM-deficient JP2 strain (ΔlasI) demonstrated that T2R14 deficient cells exhibited significantly decreased innate immune marker secretion, particularly in response to wild-type bacteria .

What methodologies effectively differentiate between TAS2R14 agonists and antagonists?

Differentiating between TAS2R14 agonists and antagonists requires systematic approaches:

  • Concentration-response curves: Complete dose-response relationships should be established for potential ligands. TAS2R14 shows concentration-dependent responses to known agonists like bacterial quorum sensing molecule C12 (EC₅₀ ≈ 100 μM) and fungal quorum sensing molecules tyrosol (EC₅₀ ≈ 100 μM) and farnesol (EC₅₀ ≈ 120 μM) .

  • Competitive binding assays: Testing compounds in the presence of known agonists can reveal antagonistic properties. Prior to recent research, only 3 antagonists were known for TAS2R14 despite its having over 150 known agonists .

  • Functional readout diversity: Measuring multiple downstream events (calcium flux, cAMP inhibition, receptor internalization) provides a more complete profile of ligand activity. For instance, T2R14-Gαi specific signaling leads to increased calcium mobilization, and this pathway can be manipulated to distinguish activating versus inhibiting compounds .

  • Mixed experimental/computational approaches: An iterative methodology combining experimental screening with computational modeling has proven successful in identifying new TAS2R14 ligands. This approach has led to the identification of 207 new agonists and 10 new antagonists of TAS2R14 in one study .

  • Refinement of binding pocket predictions: As more active compounds are identified, binding pocket models can be refined to improve structure-based virtual screening reliability, despite the lack of experimental receptor structures .

How does TAS2R14 signal transduction differ between gustatory and non-gustatory tissues?

TAS2R14 utilizes different signaling mechanisms depending on tissue context:

  • Canonical bitter taste signaling: In taste cells, TAS2R14 typically couples to gustducin (Gα-gust), leading to phosphodiesterase activation and cAMP degradation, while the released Gβγ dimer promotes calcium release through the PLCβ-IP₃-IP₃R pathway .

  • Airway epithelial signaling: In airway epithelial cells, TAS2R14 predominantly couples to Gαi proteins. This coupling has been demonstrated through NanoBRET assays showing specific and saturable association between TAS2R14 and Gαi but not Gαs .

  • Signaling consequences: The Gαi coupling in airways leads to inhibition of adenylyl cyclase and reduced cAMP production. Enhanced T2R14 activation in CF may lead to greater inhibition of adenylyl cyclase by Gαi and reduced cAMP production .

  • Calcium mobilization pathways: While both pathways involve calcium mobilization, the mechanisms differ. Research shows that pre-treatment with TAT-GPR peptide (which blocks Gαi) blunted the calcium response to the T2R14 agonist diphenhydramine (DPH) in both CF and non-CF cells, indicating Gαi involvement in T2R14-mediated calcium signaling .

What experimental design strategies can elucidate TAS2R14's role in detecting microbial signals?

To investigate TAS2R14's role in microbial signal detection:

  • Quorum sensing molecule (QSM) specificity testing: Comparing responses to various bacterial QSMs (e.g., C12 from P. aeruginosa, AIP-1 from S. aureus) and fungal QSMs (e.g., tyrosol and farnesol from Candida species) can establish receptor specificity profiles .

  • Genetically modified bacteria: Using bacterial strains deficient in QSM production allows for confirmation of receptor specificity. Examples include the JP2 strain of P. aeruginosa (ΔlasI) that cannot synthesize C12, and QSM-deficient S. aureus (SAur ΔAgrB) that cannot secrete AIP-1 .

  • Receptor knockdown: Comparing responses in wild-type versus TAS2R14 knockdown cells to both QSMs and live bacteria provides functional validation. T2R14 deficient cells exhibited reduced responses to wild-type bacteria, with this effect being blunted when using QSM-deficient bacterial strains .

  • Pathway inhibition studies: Using specific inhibitors of downstream signaling components can elucidate the mechanisms connecting receptor activation to physiological responses. Inhibitors of nitric oxide synthase (NOS) reduced nitrate release evoked by C12, supporting the involvement of this pathway in TAS2R14-mediated responses .

  • Calcium and cAMP measurement: Simultaneous measurement of calcium mobilization and cAMP levels in response to microbial signals can provide insights into the signaling mechanisms involved. T2R14-dependent significant calcium mobilization has been observed in response to bacterial and fungal QSMs .

What are the major challenges in developing selective modulators of TAS2R14?

Developing selective modulators for TAS2R14 faces several challenges:

  • Receptor promiscuity: TAS2R14 is the most promiscuous member of the bitter taste receptor family, with over 150 known agonists and formerly few known antagonists, making selectivity difficult to achieve .

  • Structural information limitations: The lack of experimental structures for TAS2R14 hampers structure-based drug design efforts. Researchers have had to rely on predicted structures, which require iterative refinement based on experimental data .

  • Signaling complexity: TAS2R14 engages multiple downstream signaling pathways, and the relative importance of these pathways may vary by tissue and physiological context .

  • Species differences: Variations in TAS2R14 sequence and pharmacology across species (including between humans and Papio hamadryas) may complicate the translation of findings between model systems.

  • Heterogeneous expression: The variable expression of TAS2R14 in different tissues and disease states (such as the upregulation observed in CF cells) adds complexity to modulator development and testing .

How can computational methods improve the study of TAS2R14 structure-function relationships?

Computational approaches offer valuable tools for TAS2R14 research:

  • Homology modeling: Despite the lack of crystal structures, homology models based on related GPCRs can provide initial structural insights, though these require experimental validation.

  • Iterative model refinement: As demonstrated in research, an iterative approach that incorporates experimental data from newly identified ligands can progressively improve binding pocket predictions and virtual screening performance .

  • Molecular dynamics simulations: These can provide insights into receptor conformational changes upon ligand binding and help identify residues involved in activation processes.

  • Virtual screening: Computational screening of compound libraries against refined TAS2R14 models can identify potential new ligands for experimental testing. This approach has contributed to the discovery of numerous new agonists and antagonists .

  • Pharmacophore modeling: Based on known active compounds, pharmacophore models can be developed to predict features essential for TAS2R14 binding and modulation.

What techniques are most effective for studying Papio hamadryas TAS2R14 in comparison to human TAS2R14?

For comparative studies between species variants:

  • Sequence and structural alignments: Detailed comparison of sequence homology and predicted structural differences between Papio hamadryas and human TAS2R14 can identify conserved and divergent regions that may influence function.

  • Cross-species pharmacological profiling: Systematically testing the same panel of compounds against both receptor variants can identify species-specific differences in ligand recognition and response profiles.

  • Chimeric receptors: Creating chimeric receptors with domains from both species can help identify regions responsible for functional differences.

  • Site-directed mutagenesis: Converting specific amino acids in one species variant to the corresponding residues in the other can pinpoint key determinants of species-specific responses.

  • Comparative signaling analysis: Investigating whether the two species variants couple to the same G proteins and activate the same downstream pathways with similar efficacies provides functional insights.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.