Recombinant Papio hamadryas Taste receptor type 2 member 16 (TAS2R16)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms

TAS2R16 activates a signaling cascade upon binding bitter ligands, leading to Gαi protein-mediated inhibition of adenylate cyclase and depolarization via TRPM5 channels . Critical residues for ligand specificity and signal transduction include:

  • TM3/TM7 residues: Hydrophobic interactions (e.g., W261) form a broad ligand-binding pocket accommodating diverse β-glycosides .

  • N96: Polymorphisms (e.g., N96T) modulate receptor sensitivity to ligands like salicin .

ResidueRoleEffect of Mutation
W261Ligand binding (4-nitrophenyl glycosides)W261A increases EC₅₀ for 4-nitrophenyl ligands
N96Modulates receptor sensitivity to salicinN96T reduces EC₅₀ by ~5-fold
TM5/TM7Signal transduction (38 residues critical for calcium flux) Mutations abolish receptor activation

Genetic Variations and Evolutionary Adaptations

TAS2R16 exhibits polymorphisms influencing bitter perception. While Papio hamadryas-specific SNPs are understudied, comparative primate studies highlight functional divergence:

SNPAlleleEffectPopulationSource
rs978739T/CDominant CC/CT linked to bitter sensitivityHumans
rs860170T/CTT genotype associated with lower MS riskHumans
N96TN→TEnhanced salicin sensitivityHigher primates

In primates, TAS2R16 evolution reflects dietary adaptations. For example, Japanese macaques exhibit reduced salicin sensitivity due to TM5/TM7 mutations , whereas human TAS2R16 variants (e.g., K172N) enhance bitter detection .

Research Applications

Recombinant TAS2R16 is used in:

  1. Ligand Screening: Identifying bitter compounds (e.g., 4-nitrophenyl glycosides) .

  2. Inhibitor Studies: Probenecid blocks TAS2R16 by binding intracellular domains, suppressing salicin perception .

  3. Evolutionary Analyses: Comparing primate TAS2R16s to trace dietary adaptations .

Table 1: Key Residues in TAS2R16 Ligand Binding

ResidueDomainLigand InteractionMutation Impact
W261TM74-Nitrophenyl glycosidesW261A → Reduced activation
N96TM2Salicin bindingN96T → Higher sensitivity
C481TM5Signal transductionC481T → Loss of function

Table 2: TAS2R16 SNPs and Functional Effects

SNPAllelePhenotypePopulationSource
rs978739CCHigh bitter sensitivityHumans
rs860170TTLower MS riskHumans
K172NNEnhanced salicin detectionHumans/Sakis

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R16; Taste receptor type 2 member 16; T2R16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MIPIQLSVFFMIIYVLESLTIIVQSSLIVAVLGREWLQIRRLMPVDMILISLGISRFCLQ WTSMLNDFCFYFNFNYVLCNLTITWTFFNVLTFWLNSLLTVFYCIKVSSFTHPIVLWLRW RILRWLPWLLLGCLMITCVTIIPSAIGNYIQIQFLTMEHPPRNSTVIDRLQKFHQYLHQA HTVALVIPFILFLASTILLMASLTKQIQHHGTGHCNPSMKAHFTALRSLAILFIVFTSYF LTILITMIGTLFDKRCWLWVWEAFVYAFIFMHSTSLMLSSPTLKRILNGKC
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is gustducin-linked. It may also contribute to sensing the chemical composition of the gastrointestinal content. Activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TAS2R16 and what is its primary function in primate biology?

TAS2R16 belongs to the bitter taste receptor family (TAS2Rs), which comprises 25 members of highly divergent receptor proteins in humans that mediate bitter taste perception. These receptors function as G protein-coupled receptors and are expressed not only in taste cells but also in the respiratory and gastrointestinal tracts. TAS2R16 specifically responds to approximately 30 different β-glucoside compounds, whose molecular scaffold consists of a D-glucose monosaccharide linked by an oxygen atom to a phenyl group . Many plants, particularly cruciferous vegetables like broccoli and brussels sprouts, contain bitter β-glucosides including salicin, sinigrin, arbutin, and amygdalin. TAS2R16 plays a central role in determining primate preferences for consuming or avoiding such vegetables, which ultimately influences dietary choices and health outcomes . The receptor achieves high specificity while maintaining the ability to accommodate diverse chemical structures, allowing it to detect potentially toxic bitter compounds without causing all foods to taste bitter. This detection mechanism is believed to have evolved as a protective measure against the ingestion of potentially harmful plant toxins.

How does TAS2R16 structure influence its ligand binding capabilities?

TAS2R16 has evolved a sophisticated structure that enables both broad reactivity and high specificity for β-glycoside detection. Comprehensive structure-function analyses have identified 13 residues that contribute specifically to ligand interactions and 38 residues whose mutation eliminated signal transduction by all ligands tested . The binding pocket appears to contain hydrophobic residues on transmembrane domains 3 and 7 that form a broad ligand-binding pocket capable of accommodating diverse structural features of β-glycoside ligands while maintaining specificity . This structural arrangement allows TAS2R16 to recognize a common molecular scaffold while still accommodating variations within that class. Research has demonstrated that TAS2R16 can detect not only β-glucosides but also phenolic β-mannosides and more complex phenolic β-glucosides from plants, suggesting it serves a broader role in bitter compound detection than initially thought . Position 261, specifically the tryptophan residue at this location, appears particularly important for determining ligand specificity, with the W261A mutation causing divergent responses to different β-glycoside structures - increasing EC50 values for some compounds while decreasing them for others .

What evolutionary patterns are observed in TAS2R genes across primate species?

The evolutionary trajectory of TAS2R genes shows complex patterns across primate lineages, with significant variations in the number of intact versus disrupted genes. Research on cercopithecid monkeys (Old World monkeys) has revealed interesting evolutionary patterns, particularly between omnivorous cercopithecines and folivorous colobines . Advanced sequencing methods using targeted capture followed by high-depth massive-parallel sequencing have demonstrated that colobines have a markedly reduced number of intact TAS2R genes (25-28) compared to cercopithecines (27-36) . This finding contradicts the simple prediction that herbivory would favor more TAS2R genes for plant compound detection. The common ancestors of these two subfamilies followed divergent evolutionary paths, with the colobine ancestor experiencing four gene "deaths" while the cercopithecine ancestor underwent three gene "births" . These patterns suggest that TAS2R gene evolution is influenced by complex ecological factors rather than simply by the proportion of plant material in the diet. Birth or death events in TAS2R genes have occurred at almost every phylogenetic branch point, creating variable compositions of intact genes even among closely related species .

What expression systems are most effective for producing functional recombinant Papio hamadryas TAS2R16?

For functional studies of Papio hamadryas TAS2R16, mammalian expression systems typically provide the most reliable results due to their appropriate post-translational modification capabilities. HEK293 cells represent a widely used platform for bitter taste receptor expression, as they provide the cellular machinery necessary for proper receptor folding, trafficking, and membrane insertion. When designing expression constructs, inclusion of an N-terminal epitope tag (such as FLAG or HA) facilitates detection and purification without interfering with C-terminal G protein coupling domains. Codon optimization specific to the expression system is essential for maximizing protein production levels, particularly when expressing baboon proteins in human or hamster cell lines. For enhanced membrane targeting, inclusion of a signal sequence and potentially rhodopsin-derived N-terminal sequences can improve surface expression. When studying receptor activation, co-expression with chimeric G proteins (such as Gα16-gust44) can amplify calcium signaling responses and improve assay sensitivity. For structural studies requiring larger protein quantities, insect cell expression using baculovirus vectors may provide higher yields, though functional verification in mammalian systems remains essential. Throughout the expression process, careful temperature control during protein induction (typically 30°C rather than 37°C) can favor proper folding over expression speed, a critical consideration for GPCRs like TAS2R16.

What are the most effective assays for characterizing TAS2R16 activation by different ligands?

Multiple complementary techniques provide robust approaches for characterizing TAS2R16 activation patterns across different ligands. Calcium imaging assays represent one of the most widely used methods, as TAS2R activation typically leads to increases in intracellular calcium that can be measured using fluorescent calcium indicators like Fura-2 or fluo-4. These assays can be conducted in real-time and allow for dose-response characterizations as demonstrated in studies examining how different ligands such as salicin, 4-nitrophenyl-β-D-mannopyranoside, hexyl-β-D-glucopyranoside, and phenyl-N-acetyl-β-D-glucosaminide activate TAS2R16 . For higher throughput screening, fluorometric imaging plate reader (FLIPR) assays enable simultaneous testing of multiple compounds in 96- or 384-well formats. Reporter gene assays using elements responsive to calcium or cAMP signaling provide an alternative measurement approach with potentially higher signal-to-noise ratios for weakly activating compounds. Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) techniques can provide more direct measurement of receptor conformational changes or protein-protein interactions during activation. When comparing Papio hamadryas TAS2R16 with human orthologs, standardizing experimental conditions is crucial to ensure that observed differences truly reflect species-specific receptor properties rather than methodological variations.

How can mutations in TAS2R16 be effectively analyzed to understand structure-function relationships?

Systematic mutational analysis represents a powerful approach for investigating structure-function relationships in TAS2R16. Comprehensive mutation libraries, in which each amino acid position is individually mutated, provide a thorough way to evaluate the importance of specific residues for receptor function . After generating such mutation libraries through site-directed mutagenesis techniques, functional characterization through calcium mobilization or other signaling assays can identify residues critical for ligand binding versus those important for signal transduction. The W261A mutation in TAS2R16 exemplifies how specific mutations can provide insights into ligand recognition mechanisms, as this mutation caused increased EC50 values (reduced sensitivity) for salicin and phenyl-β-glucoside but decreased EC50 values (enhanced sensitivity) for 4-nitrophenyl-substituted ligands . This differential effect reveals important information about how this residue interacts with different chemical structures. When comparing orthologs across species, naturally occurring variations can be engineered into recombinant receptors to determine how evolutionary changes affect function, as demonstrated by studies of the N96T mutation that increases sensitivity to both salicin and 4-NP-β-mannoside . Molecular modeling approaches using homology models based on crystallized GPCRs can complement experimental mutational data by predicting the three-dimensional consequences of specific mutations and how they might alter the binding pocket architecture.

How does TAS2R16 from Papio hamadryas compare functionally with human TAS2R16?

Functional comparison between Papio hamadryas TAS2R16 and human TAS2R16 requires careful characterization of ligand responses using identical experimental conditions to identify true species-specific differences. One potentially significant difference involves position 96, where humans have asparagine while many non-human mammals have threonine. Research has shown that the N96T mutation in human TAS2R16 decreases the EC50 for activation by both salicin and 4-NP-β-mannoside by approximately 5-fold, suggesting increased sensitivity . If Papio hamadryas TAS2R16 naturally contains threonine at this position, it might exhibit higher sensitivity to certain bitter compounds compared to the human receptor. When examining dose-response relationships, researchers should analyze both EC50 values (indicating potency) and maximal response levels (indicating efficacy) across a range of structurally diverse β-glycosides. Differences in receptor expression levels must be carefully controlled, potentially through quantitative western blotting or cell surface ELISA using epitope-tagged constructs. Beyond simple activation parameters, investigation of G protein coupling preferences, receptor internalization rates, and desensitization patterns may reveal subtle functional differences that reflect species-specific adaptations. The ecological significance of these differences may correlate with the greater dietary flexibility of baboons compared to humans' ancestral diet, potentially requiring different detection thresholds for plant toxins encountered in their natural habitat.

What insights does comparative genomic analysis of TAS2R genes provide about primate dietary evolution?

Comparative genomic analyses of TAS2R genes across primates have revealed complex evolutionary patterns that challenge simple correlations between diet and bitter taste receptor repertoire. Targeted capture sequencing approaches examining TAS2R genes in cercopithecid monkeys have demonstrated that folivorous (leaf-eating) colobines possess fewer intact TAS2R genes (25-28) compared to omnivorous cercopithecines (27-36) . This surprising finding contradicts the hypothesis that herbivorous animals would require more bitter taste receptors to discriminate among potential food plants with varying toxicity profiles. The evolutionary trajectory of TAS2R genes shows multiple gene "birth" and "death" events across primate lineages, with the colobine common ancestor experiencing four gene "deaths" while the cercopithecine common ancestor underwent three gene "births" . These patterns suggest that selective pressures on bitter taste perception are more complex than simply correlating with the proportion of plant material in the diet. Alternative explanations might include the development of post-ingestive detoxification mechanisms in folivorous primates that reduce reliance on pre-ingestive detection, or specialization on particular plant families that require detection of specific bitter compounds rather than a broad array. The variable composition of intact TAS2R genes among closely related species indicates ongoing adaptation to local ecological conditions and dietary opportunities.

What molecular modeling approaches best predict TAS2R16-ligand interactions?

Molecular modeling of TAS2R16-ligand interactions requires sophisticated computational approaches to overcome the lack of experimentally determined crystal structures for bitter taste receptors. Homology modeling based on structurally characterized class A GPCRs provides the foundation, with multiple template structures combined to optimize model quality for different receptor regions. Ligand docking simulations can then predict binding modes for β-glycosides such as salicin and related compounds, generating hypotheses about key interactions that can be tested experimentally. Molecular dynamics simulations extending into the microsecond range allow exploration of binding pocket flexibility and conformational changes associated with receptor activation. These simulations can incorporate experimental findings, such as the differential effects of the W261A mutation on different ligands, to refine binding mode predictions . Quantum mechanical calculations may be necessary to accurately model specific interactions like hydrogen bonding and π-stacking between ligands and binding pocket residues. Fragment-based approaches can systematically evaluate how different structural components of β-glycosides (sugar moiety, linkage oxygen, and phenyl R-group) interact with specific receptor residues. For comparing Papio hamadryas TAS2R16 with human orthologs, models incorporating species-specific substitutions can predict how evolutionary changes affect binding pocket architecture and ligand recognition. The N96T polymorphism, which affects receptor sensitivity to multiple ligands, warrants particular attention in such comparative models to understand its structural consequences .

How should dose-response data for TAS2R16 activation be analyzed and interpreted?

Rigorous analysis and interpretation of dose-response data are crucial for understanding TAS2R16 pharmacology and comparing results across studies or species. When generating dose-response curves for receptor activation by various ligands, researchers should employ nonlinear regression analysis to determine EC50 values, which represent the concentration producing half-maximal response and serve as quantitative measures of ligand potency. For example, studies with human TAS2R16 have shown that structurally diverse β-glycosides like 4-nitrophenyl-β-D-mannopyranoside, hexyl-β-D-glucopyranoside, and phenyl-N-acetyl-β-D-glucosaminide activate the receptor with EC50 values ranging from 0.65 mM to 2.5 mM, representing only a roughly four-fold difference despite substantial structural variations . When comparing wild-type receptors with mutant variants, changes in EC50 values provide insights into how specific residues contribute to ligand recognition. The W261A mutation in TAS2R16 demonstrated how a single amino acid substitution can differentially affect responses to ligands with different structural features, increasing EC50 values for salicin and phenyl-β-glucoside while decreasing EC50 values for compounds with 4-nitrophenyl substitutions . Beyond EC50 values, Hill coefficients should be examined as potential indicators of cooperativity or multiple binding sites, while maximum response values (Emax) help distinguish full from partial agonists. Statistical comparison between dose-response curves should employ appropriate tests like the extra sum-of-squares F test rather than simply comparing EC50 values in isolation.

What controls are essential when comparing TAS2R16 orthologs from different primate species?

Rigorous experimental controls are essential when comparing TAS2R16 orthologs from different primate species to ensure observed differences reflect true species-specific properties rather than methodological variables. First, expression level controls are critical, as differences in surface receptor density can profoundly affect apparent sensitivity and response magnitude. This can be addressed through quantitative western blotting, ELISA of surface expression using identical epitope tags, or flow cytometry with antibodies recognizing standardized tags. Second, transfection efficiency controls using co-expressed reporter genes or bicistronic constructs help normalize for cell-to-cell variations in expression. Third, cell background controls should include testing both orthologs in multiple cell lines to ensure observed differences are consistent across cellular contexts. Fourth, positive control compounds known to activate both orthologs should be included to establish a baseline for comparison and verify general receptor functionality. Fifth, negative controls including closely related compounds that do not activate TAS2R16 help confirm specificity of observed responses. Sixth, G protein coupling controls, potentially including co-expression with several different G protein subtypes, can identify potential differences in signaling pathway preferences between orthologs. Seventh, time course controls examining response kinetics can reveal differences in activation speed, desensitization, or internalization that might be missed in endpoint assays. Finally, independent validation using different detection methods for receptor activation provides greater confidence that observed differences are robust across methodological approaches.

How can targeted sequencing approaches improve the characterization of TAS2R genes compared to whole genome assembly analysis?

Targeted sequencing approaches offer significant advantages over whole genome assembly (WGA) analysis for characterizing TAS2R genes, particularly for comparative studies across species. Research has demonstrated that targeted capture methods specifically probing TAS2R genes followed by high-depth massive-parallel sequencing retrieve more intact TAS2R genes than found in publicly available WGA databases . For example, in cercopithecines, targeted capture methods detected 27-36 intact TAS2R genes compared to 19-30 detected via WGA analysis, while in colobines, targeted capture identified 25-28 intact genes versus 20-26 from WGA analysis . This improved detection stems from several advantages: First, targeted approaches achieve much higher sequencing depth for regions of interest, reducing ambiguities caused by sequencing errors or heterozygosity. Second, they overcome challenges posed by the inherent incompleteness of many WGA databases, particularly for multigene families with high sequence similarity. Third, by designing probes based on all potential TAS2R genes from related species, targeted approaches can capture novel or divergent genes that might be missed in reference-based analyses. Fourth, higher coverage enables more accurate identification of pseudogenes versus intact genes, as frameshift mutations or premature stop codons are less likely to be sequencing artifacts. Fifth, targeted approaches facilitate studying species without available reference genomes or with only low-quality assemblies. Finally, the focused nature of targeted sequencing makes it cost-effective for analyzing specific gene families across multiple species, enabling broader comparative studies than would be feasible with whole genome sequencing.

What emerging technologies could advance our understanding of TAS2R16 function and evolution?

Emerging technologies across multiple disciplines promise to revolutionize our understanding of TAS2R16 function and evolution. Cryo-electron microscopy (cryo-EM) techniques, which have successfully resolved structures of other challenging GPCRs, may finally provide direct structural insights into TAS2R16, potentially revealing the precise architecture of the ligand-binding pocket that has thus far been inferred primarily through mutagenesis studies. Single-cell RNA sequencing applied to taste bud cells could elucidate the co-expression patterns of TAS2R16 with other bitter taste receptors and signaling components, providing a more complete picture of the bitter taste transduction machinery in different primate species. CRISPR-Cas9 gene editing technology enables the generation of precise point mutations in the endogenous TAS2R16 gene of model organisms, allowing for the study of receptor variants in a more physiologically relevant context than heterologous expression systems. Advanced microfluidic systems could enable high-throughput functional screening of TAS2R16 variants against diverse compound libraries, potentially identifying species-specific ligands with ecological relevance. Long-read sequencing technologies offer improved ability to sequence complex genomic regions containing multiple related genes, potentially resolving ambiguities in the genomic organization of TAS2R gene clusters that have been challenging to characterize with short-read technologies . Artificial intelligence approaches, including deep learning models trained on receptor-ligand interaction data, could predict novel ligands for TAS2R16 and guide targeted screening efforts to understand the full range of compounds detected by this receptor across species.

How might comprehensive structure-function studies of TAS2R16 inform therapeutic applications?

Comprehensive structure-function studies of TAS2R16 have potential implications beyond basic evolutionary biology, extending to possible therapeutic applications targeting bitter taste receptors. Detailed understanding of the binding pocket architecture that allows TAS2R16 to recognize diverse β-glycosides while maintaining specificity could inform drug design strategies seeking either to activate or block bitter taste receptors expressed in extraoral tissues. The identification of key residues, such as those at position 96 and 261, that significantly influence receptor sensitivity provides potential targets for rational drug design aimed at modulating receptor function . Given the expression of TAS2R16 in the gastrointestinal tract, respiratory system, and other non-gustatory tissues, compounds that selectively modulate its activity might have applications in treating digestive disorders, respiratory conditions, or metabolic diseases. Comparative analysis between human and non-human primate TAS2R16, particularly focusing on the N96T polymorphism that increases sensitivity to multiple ligands, might reveal natural variations that could be leveraged for therapeutic advantage . Structure-based virtual screening approaches informed by detailed models of the TAS2R16 binding pocket could identify novel modulators with improved potency, selectivity, or pharmacokinetic properties compared to natural ligands. The identification of biased ligands that preferentially activate certain downstream signaling pathways over others could enable fine-tuned modulation of receptor function in different tissues. Understanding how TAS2R16 polymorphisms influence individual variations in taste perception might also have implications for personalized approaches to improving medication compliance by reducing bitterness in oral formulations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.