Recombinant Papio hamadryas Taste receptor type 2 member 20 (TAS2R20)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Papio hamadryas TAS2R20

Recombinant Papio hamadryas Taste receptor type 2 member 20 (TAS2R20) is a synthetic version of the bitter taste receptor protein encoded by the TAS2R20 gene in baboons (Papio hamadryas). This G protein-coupled receptor (GPCR) belongs to the TAS2R family, which mediates bitter taste perception and plays roles in detoxification and extraoral chemosensation .

Production and Purification

ParameterDetailsSource
Host OrganismE. coli (most common), yeast, or mammalian/baculovirus systems
Purity>85% (SDS-PAGE); >90% for E. coli-derived full-length proteins
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50% for stability)

Functional Studies and Ligand Interactions

TAS2R20 is activated by bitter compounds, including vanillin, as demonstrated in in vitro assays. Functional studies reveal its role in detecting xenobiotics and influencing metabolic and immune responses .

Key Functional Data

Ligand/ParameterResultSource
Vanillin ActivationEC₅₀ = 0.53 ± 0.09 mM (concentration-dependent activation)
Receptor TuningNarrowly tuned (responds to specific bitterants)
Extraoral ExpressionDetected in gastrointestinal and skin tissues (chemosensory roles)

Genetic and Evolutionary Insights

TAS2R20 exhibits high nucleotide diversity (π = 0.358%) compared to other TAS2Rs, suggesting adaptive evolution . Population studies highlight species-specific haplotypes and functional divergence, particularly in primates .

Genetic Diversity Metrics

MetricTAS2R20 ValueGenome-Wide ReferenceSource
Nucleotide Diversity (π)0.358% (highest among TAS2Rs)Mean π = 0.12%
Tajima’s D−0.25 (suggests excess of low-frequency alleles)
FST (Population Differentiation)0.258 (high differentiation)Genome-wide mean: ~0.01

Applications and Research Implications

Recombinant TAS2R20 is used in bitter taste assays, food science, and pharmacology. Its activation by vanillin (a common food additive) has implications for flavor modulation and metabolic health .

Research Applications

AreaUse CaseSource
Food ScienceIdentifying bitter compounds in vanilla and optimizing flavor profiles
PharmacologyStudying TAS2R20’s role in gut microbiota modulation and metabolic regulation
Genetic ScreeningMapping population-level variation in bitter taste perception

Challenges and Future Directions

  1. Functional Specificity: TAS2R20’s ligand repertoire remains understudied beyond vanillin .

  2. Structural Insights: Crystallographic data are needed to map binding pockets and interactions.

  3. Evolutionary Dynamics: Further studies on TAS2R20’s role in dietary adaptation across primates are warranted .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
TAS2R20; TAS2R49; Taste receptor type 2 member 20; Taste receptor type 2 member 49; T2R49
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLW VILLHWYSTVLNPTSSNLKVTIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHH LKRKAKSVVLVIVLGSLFFLVCHLVMKNTYINVWTEEYEGNVTWKIKLRNAMHLSNLTVA MLANLIPFTLTLISFLLLIYSLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAI YFLCLITSFWNXKMRPKEIVLMLCQAFGIIYPSFHSFILIWGNKTLKQTFLSVLWRVTCW AKGQNQSTP
Uniprot No.

Target Background

Function
This receptor, involved in taste perception, potentially plays a role in sensing bitterness and is gustducin-linked. It may also contribute to sensing the chemical composition of the gastrointestinal content. The receptor's activity can stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How should researchers store and handle recombinant TAS2R20 for experimental use?

For optimal experimental results, recombinant Papio hamadryas TAS2R20 should be stored at -20°C for regular use or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for protein stability .

Methodological considerations for handling:

  • Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and reduced activity

  • Prepare working aliquots and store them at 4°C for up to one week to minimize freeze-thaw cycles

  • When using the protein for functional assays, allow it to equilibrate to room temperature slowly before experimentation

  • Ensure proper pH conditions during experimental procedures, as pH shifts can affect the tertiary structure and function of the receptor

What methods are commonly used to study TAS2R20 expression patterns in Papio hamadryas tissues?

RNA sequencing is the primary method used to study expression patterns of taste receptors across different tissues. Based on approaches similar to those used in amphibian studies, researchers typically:

  • Collect tissue samples from various organs including the tongue, brain, skin, stomach, intestines, and liver

  • Extract total RNA using standard protocols such as TRIzol extraction followed by DNase treatment

  • Prepare RNA-seq libraries and perform high-throughput sequencing

  • Analyze the resulting data using bioinformatics pipelines to quantify expression levels

  • Validate findings using quantitative PCR (qPCR) for selected targets

For visualization of expression patterns, in situ hybridization techniques can be employed to localize TAS2R20 mRNA in tissue sections, while immunohistochemistry using specific antibodies helps identify the receptor at the protein level.

How do TAS2R genes differ between Papio hamadryas and other primate species?

TAS2R gene composition varies significantly across primate species due to complex evolutionary processes including gene births and deaths. While the specific information about TAS2R20 in Papio hamadryas compared to other primates is limited in the provided search results, we can extract relevant comparative data:

Primate GroupNumber of Intact TAS2R GenesEvolutionary Trajectory
Colobines25-28 (TC method); 20-26 (WGA method)Four gene "deaths" at common ancestor
Cercopithecines (including Papio)27-36 (TC method); 19-30 (WGA method)Three gene births at common ancestor

Within the Papio genus, Papio anubis (closely related to P. hamadryas) possesses two copies of the T2R14 gene (Paan_892_851, Paan_086_045), indicating potential gene duplication events within this genus . The composition of intact TAS2R genes varies among species due to birth and death events occurring at almost every phylogenetic branch, making each species' TAS2R repertoire somewhat unique .

What evolutionary forces have shaped TAS2R20 in Papio hamadryas and how can researchers investigate selective pressures?

The evolution of TAS2R genes in primates, including TAS2R20 in Papio hamadryas, has been shaped by complex selective pressures related to diet, ecology, and toxin exposure. To investigate these evolutionary forces, researchers should employ multiple approaches:

  • Molecular evolutionary analyses: Calculate dN/dS ratios (ratio of non-synonymous to synonymous substitution rates) to detect positive selection signals. Values significantly greater than 1 indicate positive selection, suggesting adaptive evolution.

  • Comparative genomics approaches: Apply Ornstein-Uhlenbeck (OU) and Brownian Motion (BM) models to analyze the evolution of TAS2R gene family size across vertebrates. The OU model incorporates the concept of selective optima toward which traits evolve through positive selection, while BM models trait evolution as a random walk .

How can heterologous expression systems be optimized for functional characterization of recombinant Papio hamadryas TAS2R20?

For optimal functional characterization of recombinant P. hamadryas TAS2R20, researchers should consider:

  • Expression system selection: HEK293T or CHO cells are commonly used for TAS2R studies due to their high transfection efficiency and minimal endogenous taste receptor expression.

  • Vector optimization: Use vectors with strong promoters (CMV) and include elements that enhance surface expression of GPCRs such as the first 45 amino acids of rat somatostatin receptor type 3.

  • Assay methodology:

    • Calcium imaging using fluorescent calcium indicators (Fluo-4 AM)

    • FLIPR (Fluorescent Imaging Plate Reader) for high-throughput screening

    • Bioluminescence resonance energy transfer (BRET) assays to monitor G-protein coupling

  • Control inclusions:

    • Positive controls: Well-characterized bitter compounds (quinine, denatonium)

    • Negative controls: Non-transfected cells and sweet compounds

    • Cross-validation with known ligands of other TAS2Rs

  • Data analysis protocols:

    • Dose-response curves to determine EC50 values

    • Hill coefficients to assess cooperativity

    • Statistical methods for comparing responses across different ligands and receptor variants

What is the relationship between TAS2R20 expression patterns and extra-oral functions in primates?

While the search results don't specifically address extra-oral functions of TAS2R20 in Papio hamadryas, studies in other vertebrates provide a framework for investigation. Research on amphibians suggests that expanded TAS2R repertoires correlate with increased extra-oral expression and utilization of these receptors .

For investigating extra-oral TAS2R20 functions in Papio hamadryas, researchers should:

  • Comprehensive tissue expression profiling: Quantify TAS2R20 expression across multiple tissues (brain, skin, gut, respiratory system, etc.) using RNA-seq and qPCR.

  • Functional correlation analyses: Correlate expression levels with physiological parameters specific to each tissue to identify potential functional roles.

  • Tissue-specific knockdown experiments: Use siRNA or CRISPR-Cas9 to reduce TAS2R20 expression in specific tissues and observe physiological consequences.

  • Receptor activation studies: Apply known TAS2R20 ligands to tissue explants or primary cell cultures from different organs and measure cellular responses.

Research indicates that tissues derived from the same germ layer often show similar TAS2R expression profiles. For instance, brain and skin (both ectodermal) tend to cluster together in expression analyses, while stomach, intestines, and liver (all endodermal) share similar expression patterns . This developmental relationship provides a framework for predicting and investigating the extra-oral functions of TAS2R20.

How do specific amino acid variations in TAS2R20 affect ligand binding profiles and receptor activation?

To investigate structure-function relationships in Papio hamadryas TAS2R20, researchers should employ:

  • Site-directed mutagenesis: Systematically alter key amino acids, particularly in transmembrane domains and extracellular loops, to identify residues critical for ligand binding and receptor activation.

  • Homology modeling and molecular docking: Create 3D models of TAS2R20 based on known GPCR structures, then perform in silico docking studies with potential ligands to predict binding sites and interactions.

  • Chimeric receptor studies: Construct chimeric receptors by exchanging domains between TAS2R20 and other TAS2Rs with known ligand profiles to determine which regions confer ligand specificity.

  • Correlation of natural sequence variations with function: Compare TAS2R20 sequences across different primate species and correlate amino acid differences with known dietary preferences and bitter compound tolerance.

Different T2Rs recognize specific plant chemicals: T2R14 responds to noscapine from Papaver spp., T2R16 detects salicin found in Salix spp., and T2R38 reacts to isothiocyanates from Brassicaceae plants . Although the specific ligand profile of TAS2R20 is not detailed in the search results, researchers can employ similar approaches to characterize its binding specificity.

What methodological approaches can be used to study the co-evolution of TAS2R20 and dietary adaptations in Papio hamadryas populations?

To investigate the co-evolution of TAS2R20 and dietary adaptations in Papio hamadryas, researchers should implement a multi-faceted approach:

  • Population genetics studies:

    • Sequence TAS2R20 from multiple P. hamadryas populations with different dietary patterns

    • Calculate population genetics statistics (FST, π, Tajima's D) to identify signatures of selection

    • Apply haplotype-based tests (EHH, iHS) to detect recent selective sweeps

  • Ecological sampling and dietary analysis:

    • Document plant species consumed by different P. hamadryas populations

    • Analyze bitter compound content in consumed plants using LC-MS/MS

    • Correlate plant bitter compound profiles with TAS2R20 variants in corresponding populations

  • Functional validation:

    • Perform receptor activation assays using bitter compounds from plants in the baboons' diet

    • Compare activation profiles between TAS2R20 variants from different populations

    • Conduct behavioral tests to assess bitter compound preferences among different groups

  • Comparative genomics with sympatric species:

    • Compare TAS2R20 evolution in P. hamadryas with sympatric primate species that have different diets

    • Apply phylogenetic comparative methods to control for shared evolutionary history

Birth and death events of TAS2R genes occur at almost every phylogenetic branch, making the composition of intact genes variable among species . This dynamic evolutionary process suggests that TAS2R20 may show population-level variations corresponding to local dietary adaptations.

What are the common technical challenges in producing functional recombinant TAS2R20 and how can they be overcome?

Producing functional recombinant TAS2Rs, including TAS2R20, presents several technical challenges:

  • Low surface expression: TAS2Rs often show poor trafficking to the cell membrane.

    • Solution: Fusion with a well-expressed membrane protein such as rhodopsin or addition of export sequences can improve surface expression.

  • Protein instability: The seven-transmembrane structure can be unstable when expressed in heterologous systems.

    • Solution: Optimize buffer conditions (50% glycerol in Tris-based buffer has been successful) and store at -20°C or -80°C to maintain stability .

  • Glycosylation issues: Incorrect post-translational modifications can affect receptor function.

    • Solution: Use mammalian expression systems that closely mimic primate glycosylation patterns.

  • Assay sensitivity: Detecting receptor activation can be challenging.

    • Solution: Implement high-sensitivity calcium imaging techniques or design reporter systems with amplification steps.

  • Ligand solubility: Many bitter compounds have poor water solubility.

    • Solution: Use appropriate solvents (ethanol, DMSO) at concentrations that don't interfere with assays, and include proper vehicle controls.

How can researchers effectively analyze the comparative evolution of TAS2R20 across primate lineages?

For effective comparative evolutionary analysis of TAS2R20 across primate lineages, researchers should employ:

  • Comprehensive sequence sampling: Include representatives from major primate clades, with particular attention to species with diverse dietary habits.

  • Phylogenetic analysis methods:

    • Maximum likelihood and Bayesian inference for tree construction

    • Codon-based models (PAML, HyPhy) to detect positive selection at specific sites

    • Comparative analysis of evolutionary rates among lineages

  • Regime shift analysis: Apply the l1ou R package to identify shifts in evolutionary regimes across the phylogenetic tree, which can reveal branches where selection pressures on TAS2R20 have changed .

  • Model comparison: Compare the fit of Brownian Motion (BM) and Ornstein-Uhlenbeck (OU) models to understand how selection has influenced TAS2R20 evolution .

  • Ancestral sequence reconstruction: Infer ancestral TAS2R20 sequences at key nodes in the primate phylogeny to track specific amino acid changes over evolutionary time.

  • Correlation with ecological factors: Test for associations between TAS2R20 evolutionary patterns and ecological variables such as diet composition, habitat type, and sympatric species.

Research has shown that evolutionary change in intact TAS2R genes is a complex process that refutes simple predictions about the relationship between herbivory and TAS2R gene numbers , highlighting the importance of sophisticated comparative methods.

What emerging technologies will advance our understanding of TAS2R20 function and evolution?

Emerging technologies that will significantly advance TAS2R20 research include:

  • Cryo-electron microscopy (cryo-EM): Will enable determination of TAS2R20's three-dimensional structure at near-atomic resolution, providing crucial insights into ligand binding mechanisms.

  • Single-cell transcriptomics: Will reveal cell-specific expression patterns of TAS2R20 in different tissues, allowing for precise mapping of receptor distribution.

  • CRISPR-Cas9 genome editing: Will facilitate the creation of TAS2R20 knockout or modified models to study receptor function in vivo.

  • Organoid systems: Will provide physiologically relevant 3D tissue models for studying TAS2R20 function in different organs, particularly for investigating extra-oral roles.

  • Long-read sequencing technologies: Will improve the assembly of complex genomic regions containing multiple TAS2R genes, enhancing our understanding of evolutionary dynamics.

  • Spatial transcriptomics: Will enable visualization of TAS2R20 expression within the complex architecture of tissues, providing insights into its functional integration.

  • Machine learning approaches: Will help predict ligand-receptor interactions and evolutionary trajectories based on sequence data and functional characterizations.

How might understanding TAS2R20 function contribute to broader research in primate ecology and evolution?

Understanding TAS2R20 function has far-reaching implications for primate ecology and evolution research:

  • Dietary adaptation mechanisms: Insights into how TAS2R20 variants influence food choice and toxin avoidance can help explain dietary specializations and niche partitioning among primate species.

  • Evolutionary arms race dynamics: Understanding how TAS2R20 has evolved in response to plant defensive compounds illustrates coevolutionary relationships between primates and their food plants.

  • Behavioral ecology: Knowledge of bitter taste perception mechanisms can inform studies of foraging behavior, food preference, and social learning of food choices in primate societies.

  • Conservation applications: Understanding dietary adaptations mediated by TAS2R20 can inform habitat conservation efforts by highlighting the importance of specific plant species in primate diets.

  • Comparative medicine: As TAS2Rs are increasingly recognized for their extra-oral functions, primate TAS2R20 studies may provide models for understanding these receptors' roles in human health conditions.

  • Evolutionary genomics: The complex pattern of TAS2R gene births and deaths across the primate phylogeny offers a model system for studying gene family evolution and adaptation .

Research has shown that bitter or poisonous material from plants can act as a driving force for T2R evolution in herbivorous primates , highlighting the ecological significance of these receptors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.