Recombinant Papio hamadryas Taste receptor type 2 member 31 (TAS2R31)

Shipped with Ice Packs
In Stock

Description

Functional Roles

TAS2R31 plays dual roles in bitter perception and non-taste physiological processes:

  • Bitter Taste Perception: Activated by synthetic sweeteners like saccharin and acesulfame potassium .

  • Airway Smooth Muscle Relaxation: In human airways, TAS2R31 activation increases intracellular calcium, triggers potassium channel opening, and induces bronchodilation .

Key Research Findings

  • Saccharin Response: TAS2R31 is a primary receptor for saccharin in vitro, though its role in human bitter perception remains less defined compared to other TAS2Rs .

  • Acesulfame Potassium Bitterness: Polymorphisms in TAS2R31 (e.g., R35W, L162M) correlate with interindividual differences in perceiving acesulfame potassium’s bitterness .

Genetic Variations and Functional Impact

Genetic diversity in TAS2R31 influences ligand binding and perception:

VariantAmino Acid ChangeFunctional ImpactSource
R35WArginine→TryptophanReduced responsiveness to acesulfame potassium
L162MLeucine→MethionineAltered binding affinity for bitter compounds
A227V/V240IAlanine→Valine; Valine→IsoleucineModulates bitter taste perception in combination with R35W

Population Genetics:

  • Global Diversity: TAS2R31 exhibits 721 SNPs (494 nonsynonymous), with π (nucleotide diversity) averaging 0.12% .

  • Natural Selection: No strong evidence of positive selection in humans, suggesting relaxed evolutionary pressure .

Recombinant Protein Applications

The His-tagged TAS2R31 is utilized in:

  • Ligand Screening: Identifying bitter compounds and sweeteners (e.g., saccharin, acesulfame potassium) .

  • Structure-Function Studies: Mapping binding pockets via molecular docking (e.g., AutoDock Vina) .

  • Bronchodilation Research: Studying airway smooth muscle relaxation mechanisms .

Comparative Evolutionary Insights

TAS2R31 orthologs show species-specific adaptations:

SpeciesKey FeaturesSource
Papio hamadryasFull-length recombinant protein available
Pan troglodytesSimilar structure to human TAS2R31
Homo sapiensPolymorphisms linked to acesulfame potassium bitterness

Challenges and Future Directions

  • Cell Surface Expression: Recombinant TAS2R31 may require co-receptors (e.g., Gα15) for optimal function, as seen in mouse Tas2r studies .

  • Functional Orphanization: Some TAS2Rs remain uncharacterized due to insufficient agonist identification, despite cell surface localization .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R31; TAS2R44; Taste receptor type 2 member 31; T2R31; Taste receptor type 2 member 44; T2R44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MITFLPIIFSILVVVTFVIGNFANGFIALVNSTEWVKRQKISFADQILTALAVSRVGLLW VLLLNWYATVLNPAFYSVEVRTTTYNVWAVTNHFSNWLATSLSIFYLLKIANFSNLIFLH LKRRVKNVILVMLLGPLLILACHLFMVNMNEIVRTKEYEENMTWKYILRNAIYHPGMTVT TLQNLVPFTLTLISFLLLICSLCKHLKKMQLHGKGPQDPSTKVHIKALQIVISFLLLCVI YFVSVIISIWSFESLGNKPVFMFCQAIRFSYPSAHPFIVIWGNKKLKQTFLSVLWNVRYW VKGQKPSSL
Uniprot No.

Target Background

Function
This receptor potentially plays a role in the perception of bitterness and is linked to gustducin. It may contribute to sensing the chemical composition of gastrointestinal content. Activation of this receptor could stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R31 and how does it function in Papio hamadryas compared to human homologs?

TAS2R31 belongs to the taste receptor type 2 (T2R) family of G protein-coupled receptors (GPCRs) that mediate bitter taste perception. These receptors belong to Class A (rhodopsin-like) GPCRs, which comprise over 80% of all GPCRs in mammals and are involved in diverse physiological functions .

In primates including Papio hamadryas (baboon), TAS2R31 functions in the recognition of bitter compounds, triggering signal transduction pathways that lead to taste perception. The receptor is expressed in type II taste bud cells in the oral cavity and in several extraoral tissues where they may serve functions beyond taste perception .

While human TAS2R31 has been characterized as responsive to compounds like acesulfame K and quinine , the specific ligand profile of Papio hamadryas TAS2R31 likely differs based on evolutionary adaptations. Sequence variations in key binding residues between human and baboon TAS2R31 would affect their respective bitter compound recognition profiles.

What methodological approaches are recommended for expressing recombinant Papio hamadryas TAS2R31?

For successful expression of recombinant Papio hamadryas TAS2R31, researchers should consider the following methodological approach:

Expression System Selection:

  • Mammalian cell lines (HEK293T, CHO) are preferred for functional studies as they provide appropriate post-translational modifications

  • For structural studies, insect cell systems may provide higher yields

Expression Construct Design:

  • Clone the full-length Papio hamadryas TAS2R31 coding sequence

  • Incorporate a strong promoter (CMV for mammalian cells)

  • Include an N-terminal signal sequence for proper membrane targeting

  • Add affinity tags (His, FLAG) for detection and purification

  • Consider fusion partners to enhance stability and expression

Human TAS2R receptors have been successfully expressed in heterologous systems for functional characterization , providing a methodological foundation for baboon receptor expression. When designing primers for Papio hamadryas TAS2R31 amplification, researchers should note that custom assays for certain human TAS2R31 SNPs have proven challenging despite multiple technological approaches .

How do genetic variations in TAS2R31 affect bitter compound recognition in primates?

Genetic variations in TAS2R31 significantly impact bitter compound recognition in primates. In humans, specific SNPs in TAS2R31 have been associated with differential sensitivity to bitter compounds:

  • The Val240Ile (rs10772423) polymorphism in TAS2R31 significantly affects quinine bitterness perception, with bitterness significantly lower for Val240 homozygotes compared to Ile240 homozygotes

  • TAS2R31 SNPs have been associated with differential bitterness from acesulfame potassium

  • Multiple haplotypes exist due to high polymorphism rates in TAS2R genes

For Papio hamadryas, evolutionary analysis suggests that specific amino acid variations in key positions would likely affect bitter compound recognition. Position 7.42 in TAS2R46-related T2R subtypes (which would include TAS2R31) has been identified as particularly susceptible to variation, suggesting this may be a focal point for receptor adaptation to environmental pressures .

The evolutionary history of bitter taste receptors indicates independent acquisition of recognition capabilities for compounds like strychnine, suggesting convergent evolution in response to similar dietary challenges across primate lineages .

What functional assays are appropriate for characterizing Papio hamadryas TAS2R31 ligand interactions?

To characterize bitter compound interactions with recombinant Papio hamadryas TAS2R31, researchers should employ a combination of functional assays:

Calcium Mobilization Assays:

  • Transfect cells with Papio hamadryas TAS2R31 and appropriate G protein components

  • Load cells with calcium-sensitive fluorescent dyes (Fluo-4, Fura-2)

  • Measure fluorescence changes upon stimulation with candidate bitter compounds

  • Generate dose-response curves to determine EC50 values

Receptor Activation Assays:

  • Bioluminescence resonance energy transfer (BRET) assays to monitor real-time receptor activation

  • Inositol phosphate accumulation assays for measuring Gαq-mediated signaling

Data Analysis:

  • Generate concentration-response curves for different compounds

  • Calculate potency (EC50) and efficacy (Emax) parameters

  • Compare results with human TAS2R31 to identify species-specific differences

These approaches have been validated for human bitter taste receptors and can be adapted for Papio hamadryas TAS2R31 . When interpreting results, researchers should be aware that functional polymorphisms in TAS2R31 can significantly alter bitter taste responses to various compounds .

How does linkage disequilibrium between TAS2R genes complicate functional studies of TAS2R31?

Linkage disequilibrium (LD) between TAS2R genes presents a significant challenge in functional studies of TAS2R31. The search results highlight a critical example:

  • Strong LD exists between TAS2R19 and TAS2R31 SNPs, forming a haploblock

  • The Arg299Cys SNP in TAS2R19 and Val240Ile in TAS2R31 displayed a high D' value of 0.96

  • This genetic linkage makes it difficult to determine which gene is causally related to specific bitter taste phenotypes

The implications of this LD for research are profound:

  • Phenotypic associations previously attributed to one gene may actually be due to variations in the linked gene

  • For example, associations reported for rs10772420 may potentially be due to LD with polymorphism(s) in or closer to TAS2R31

  • Without accounting for LD, the true functional variants responsible for taste perception differences may be misidentified

When designing studies of Papio hamadryas TAS2R31, researchers must:

  • Assess LD patterns across relevant TAS2R genes

  • Use haplotype-based approaches rather than single-SNP analyses

  • Perform functional validation of candidate causal variants

What approaches can resolve contradictions between in vitro and in vivo studies of TAS2R31 function?

Researchers often encounter discrepancies between in vitro and in vivo studies of TAS2R31 function. To resolve these contradictions, consider the following methodological approaches:

Cellular Context Optimization

  • Use multiple cell types for expression studies

  • Include relevant G proteins and downstream signaling components

  • Compare results between heterologous systems and native taste cells

Comprehensive Functional Characterization

  • Perform dose-response analyses across wide concentration ranges

  • Measure multiple signaling outputs (calcium flux, cAMP, inositol phosphates)

  • Assess temporal dynamics of receptor activation and desensitization

Genetic Analysis Refinement

  • Account for linkage disequilibrium in association studies

  • Consider haplotype effects rather than individual SNPs

  • Validate functional effects through in vitro mutagenesis

Evidence from human studies shows that TAS2R31 polymorphisms affect perception of compounds like quinine in complex ways . The bitterness of compounds like chloramphenicol and ofloxacin has been associated with different TAS2R variants, highlighting the complexity of bitter taste perception mechanisms .

Advanced docking methods and molecular dynamics simulations, iteratively integrated with experimental tests, should be applied to overcome limitations in structural predictions of ligand binding .

How has TAS2R31 evolved across primate species and what implications does this have for Papio hamadryas research?

The evolutionary history of TAS2R31 across primates provides valuable context for Papio hamadryas research. Evidence suggests that bitter taste receptors have undergone significant selection pressures related to dietary adaptations:

  • Certain strychnine-binding key positions, especially position 7.42, in TAS2R subtypes are susceptible to variation, suggesting adaptation to environmental pressures

  • Low ratios of non-synonymous to synonymous mutation rates indicate high conservation of key amino acid sites in some T2Rs, while others show more variability

  • Independent acquisition of the ability to recognize certain bitter compounds has occurred across different T2R receptors through convergent evolution

For Papio hamadryas TAS2R31 specifically, researchers can expect:

  • Conservation of core structural elements required for GPCR function

  • Species-specific variations in binding pocket residues reflecting dietary adaptations

  • Potential evidence of selection pressures related to the baboon's natural diet

Phylogenetic analysis techniques have been used successfully to trace the evolutionary history of bitter taste receptors, allowing researchers to predict when specific compound recognition capabilities were acquired or lost .

What are the critical binding residues in TAS2R31 and how do they affect ligand selectivity?

Critical binding residues in TAS2R31 significantly impact ligand selectivity. While specific data for Papio hamadryas TAS2R31 binding residues is not detailed in the search results, insights from human TAS2R studies provide valuable reference:

Key Residues Identified in Human Studies:

  • The Val240Ile polymorphism in TAS2R31 affects quinine bitterness perception

  • Position Y241 (6.51 in Ballesteros-Weinstein notation) in the related receptor TAS2R46 is important for hydrogen bonding with ligands

  • Y241F mutation reduces receptor activation, while Y241S increases activation

Functionally important residues typically cluster in:

  • Transmembrane domains forming the binding pocket

  • Extracellular loops that interact with ligands

  • Intracellular regions involved in G-protein coupling

For Papio hamadryas TAS2R31, researchers should focus on:

  • Identifying non-conserved residues in binding regions through comparative sequence analysis

  • Creating point mutations to test the functional significance of these differences

  • Using molecular modeling to predict structural consequences of mutations

Advanced docking methods and molecular dynamics simulations, iteratively integrated with experimental validation, are recommended approaches for accurate determination of binding modes .

How does TAS2R31 expression vary across tissues in primates and what are the functional implications?

TAS2R31 expression extends beyond taste buds, with significant implications for physiological functions. Based on human and other primate studies, TAS2R31 expression in Papio hamadryas likely follows this pattern:

Expression Locations:

  • Type II taste bud cells in the oral cavity (primary site)

  • Extraoral tissues including:

    • Gastrointestinal tract - potentially regulating food intake

    • Respiratory epithelium - possibly serving as immunity sentinels

    • Reproductive tissues - may affect processes like sperm maturation

Methodological Approaches for Studying Expression:

  • RT-PCR for tissue-specific mRNA quantification

  • Immunohistochemistry for protein localization

  • In situ hybridization for cellular distribution analysis

  • Single-cell RNA sequencing for cell-type specific expression profiles

The extraoral expression of TAS2R31 suggests functions beyond taste perception. In humans, TAS2Rs have been found in several tissues throughout the body where they regulate various physiological functions including food intake in the intestine, immunity functions in airway muscles, and potentially affecting reproductive processes .

What experimental design is optimal for studying the impact of TAS2R31 polymorphisms on bitter compound perception?

An optimal experimental design for studying TAS2R31 polymorphism effects on bitter perception requires a multidisciplinary approach:

Genetic Analysis

  • Sequence TAS2R31 gene in a diverse Papio hamadryas population

  • Identify polymorphisms and determine haplotype frequencies

  • Account for linkage disequilibrium with nearby genes like TAS2R19

Functional Characterization

  • Express variant receptors in cell-based assays

  • Test responses to ecologically relevant bitter compounds

  • Determine EC50 and Emax values for each variant-compound pair

Sensory Testing (if applicable)

  • Develop behavioral assays to measure taste preferences in baboons

  • Correlate genetic variants with behavioral responses

  • Control for other factors affecting food choice

Data Analysis Framework

Analytical StepMethodsOutcome Measures
Genetic variant identificationDNA sequencing, haplotype analysisPolymorphism frequencies, LD patterns
In vitro functional testingCalcium imaging, dose-response analysisEC50 values, response magnitudes
Structure-function correlationHomology modeling, molecular dynamicsBinding site predictions, interaction maps
Statistical analysisMixed models accounting for genetic relatednessVariant effect sizes, significance levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.