Recombinant Papio hamadryas Taste receptor type 2 member 38 (TAS2R38)

Shipped with Ice Packs
In Stock

Description

Functional Studies and Research Applications

Recombinant Papio hamadryas TAS2R38 is used to investigate evolutionary divergence in bitter taste perception among primates. Key findings include:

Functional Assays

  • Calcium Imaging: Transfected HEK293 cells expressing recombinant TAS2R38 are exposed to bitter ligands, with intracellular calcium flux measured to assess receptor activation .

  • Ligand Sensitivity: Compared to human TAS2R38 (PAV/AVI haplotypes), baboon receptors may exhibit distinct dose-response profiles. For example, truncated receptors (due to stop codons) show no response to PTC .

Evolutionary Insights

  • Phylogenetic Analysis: Papio hamadryas TAS2R38 serves as an ancestral reference in haplotype networks, revealing divergence patterns in Sulawesi macaques (Macaca nigra, M. tonkeana) and Japanese macaques (M. fuscata) .

  • Adaptation: Non-functional TAS2R38 alleles in some macaque populations suggest local adaptation to dietary toxins, paralleling human and chimpanzee genetic diversity .

Comparative Genetic Analysis

The table below compares TAS2R38 variants across primates:

SpeciesKey VariantsFunctional OutcomeLigand Sensitivity (PTC)Citation
Papio hamadryasFull-length receptorHigh sensitivityEC₅₀ ~10–50 µM
Homo sapiensPAV (taster), AVI (non-taster)Polymorphism-dependentEC₅₀: PAV < AVI
Macaca nigraPremature stop codon (Q23X)Non-functionalNo response
Macaca fuscataStart codon mutation (ATG>ACG)Non-functionalNo response

Technical Protocols for Recombinant Production

  • Cloning: The TAS2R38 coding sequence is amplified from baboon genomic DNA and ligated into expression vectors with epitope tags (e.g., Myc/DDK) for detection .

  • Transfection: HEK293T cells are co-transfected with TAS2R38 and chimeric G-proteins (e.g., Gα16-gust44) to enhance signal transduction .

  • Validation: Western blotting and immunofluorescence confirm protein expression, while calcium imaging or cAMP assays measure ligand-induced activity .

Implications for Bitter Taste Research

  • Dietary Adaptation: Non-functional TAS2R38 alleles in certain primate populations correlate with reduced aversion to bitter toxins, influencing feeding ecology .

  • Medical Relevance: Human TAS2R38 polymorphisms predict alcohol intake and dietary preferences, suggesting baboon models could elucidate conserved mechanisms .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
TAS2R38; Taste receptor type 2 member 38; T2R38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MLTLTHICTVSYEVRSTFLFISVLEFAVGFLTNAFISLVNFWDVVKRQPLSNSDCVLLCL SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQVILMLWMIANQANLWLAACLSLLYCSK LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFGRLHFTVTTVLFMNNNT RLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRDSRDPSLE AHIKALKSLVSFFCFFVISSCAAFISVPLLILWHDKIGVMVCVGIMAACPSGHAAVLISG NAKLRRAVTTILLWAQSSLKVRADHMADSRTLC
Uniprot No.

Target Background

Function
This receptor may play a significant role in the perception of bitterness and is linked to gustducin. It may also contribute to sensing the chemical composition of the gastrointestinal content. Activation of this receptor can stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R38 and what is its role in taste perception?

TAS2R38 is a G protein-coupled receptor that mediates the perception of bitter compounds, most notably phenylthiocarbamide (PTC). It belongs to the taste receptor type 2 (TAS2R) family responsible for bitter taste perception, which plays an important evolutionary role in helping mammals avoid the ingestion of potentially toxic substances by inducing innate avoidance behavior . In humans, three amino acid positions (49, 262, and 296) are critical for PTC sensitivity, with common haplotypes including the PTC-taster receptor PAV (Proline 49, Alanine 262, Valine 296) and the PTC-non-taster receptor AVI (Alanine 49, Valine 262, Isoleucine 296) .

How does Papio hamadryas TAS2R38 differ from human TAS2R38?

Papio hamadryas TAS2R38 serves as an important comparative model for evolutionary studies of taste perception. While human TAS2R38 has been extensively studied, the hamadryas baboon variant provides insights into evolutionary conservation and divergence. The baboon TAS2R38 protein consists of 333 amino acids , and phylogenetic analyses have used Papio hamadryas TAS2R38 sequences (Accession number AY724835.1) as an outgroup to study the evolutionary relationships of TAS2R38 variants in other primates . Comparative studies between human and non-human primate TAS2R38 receptors help researchers understand how ecological adaptations may have shaped taste perception across different primate lineages.

What are the recommended protocols for conducting functional assays with recombinant TAS2R38?

Calcium imaging methods represent the gold standard for evaluating TAS2R38 function. A well-established protocol involves:

  • Tagging TAS2R38 at the N-terminus with the first 45 amino acids of rat somatostatin receptor type 3 for cell-surface targeting

  • Tagging the C-terminus with the last eight amino acids of bovine rhodopsin as an epitope tag

  • Inserting the tagged receptor into a mammalian expression vector (such as pEAK10)

  • Transiently transfecting HEK293T cells with the TAS2R38 construct and Gα16-gust44

  • Loading cells with a calcium-sensitive dye

  • Measuring calcium flux in response to various concentrations of bitter compounds such as PTC

When conducting dose-response analyses, researchers typically use a range of PTC concentrations (often 10^-7 to 10^-3 M) to determine EC50 values for different TAS2R38 variants.

How should recombinant TAS2R38 proteins be properly stored and handled?

For optimal stability and activity of recombinant Papio hamadryas TAS2R38 proteins:

  • Store the protein at -20°C or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles, as this can denature the protein

  • For working stocks, store aliquots at 4°C for up to one week

  • When provided as a lyophilized powder, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Consider adding glycerol (5-50% final concentration) to aliquots for long-term storage

These storage conditions help maintain protein stability and functional integrity for experimental use.

What are the best approaches for genotyping TAS2R38 in population studies?

For genotyping TAS2R38 in population studies, the following approach is recommended:

  • DNA extraction from appropriate tissue samples

  • PCR amplification of the entire coding region using primers specific to TAS2R38 (examples from previous studies include Mm-TAS2R38-F, Mm-TAS2R38-R, Mm-TAS2R38_inner-F, and Mm-TAS2R38_inner-R)

  • PCR conditions: initial denaturation at 94°C for 10 min, followed by 45 cycles of denaturation at 94°C for 10 s, annealing at 56°C for 30 s, and extension at 72°C for 1 min, with a final extension at 72°C for 10 min

  • Sequencing using standard methods such as BigDye Terminator v. 3.1

  • Sequence analysis to identify haplotypes using software such as DnaSP v. 5.1

This methodology enables researchers to accurately determine TAS2R38 variants in population studies, which is essential for understanding the genetic basis of taste perception diversity.

How can TAS2R38 function be compared across different primate species?

Comparing TAS2R38 function across primate species requires a multi-faceted approach:

  • Behavioral testing: Conduct taste preference tests with bitter compounds like PTC to assess species-specific taste sensitivities

  • Molecular genetic analysis: Sequence TAS2R38 genes from multiple individuals across species to identify variant haplotypes

  • Functional analysis: Express identified TAS2R38 variants in vitro and conduct calcium imaging assays to measure receptor activation in response to bitter compounds

  • Phylogenetic analysis: Construct genealogical relationships among haplotypes using appropriate outgroups (such as Papio hamadryas TAS2R38 when studying macaques)

This comprehensive approach allows researchers to correlate genetic variations with functional differences and evolutionary relationships. One notable example is the study of Sulawesi macaques, which revealed both within- and across-species variation in PTC taste perception, with some species possessing truncated non-functional TAS2R38 variants due to premature stop codons .

What is the significance of amino acid substitutions in TAS2R38 and how do they affect receptor function?

The functional consequences of amino acid substitutions in TAS2R38 can be profound:

Amino Acid PositionCommon VariantsFunctional Impact
49P (Proline), A (Alanine)Position 49 is critical for PTC sensitivity; P49 associates with taster phenotype
262A (Alanine), V (Valine)A262 contributes to high PTC sensitivity
296V (Valine), I (Isoleucine)V296 is present in taster haplotypes

In humans, the PAV haplotype (P49, A262, V296) encodes a high-sensitivity PTC receptor, while the AVI haplotype (A49, V262, I296) produces a non-taster receptor with minimal PTC sensitivity. Less common variants like AAI, PVI, and AAV show intermediate sensitivity to PTC . Species-specific variants, such as those found in Sulawesi macaques, may reflect adaptations to local environmental conditions and dietary bitter compounds.

How do geographical and ecological factors influence TAS2R38 evolution?

Geographical separation appears to enable independent divergence of TAS2R38 and bitter taste perception:

  • In humans, TAS2R38 haplotypes associated with intermediate bitter taste sensitivity show higher frequencies in Africa compared to other regions

  • In some primate species (e.g., M. fuscata and P. troglodytes), PTC-non-sensitive haplotypes have been found only in specific geographical areas

  • Allopatric species, such as the Sulawesi macaques, show species-specific TAS2R38 haplotypes that may reflect adaptation to local environmental conditions

These patterns suggest that local ecological factors, including the presence of specific bitter plant compounds in regional diets, may drive selective pressures on TAS2R38, resulting in population-specific adaptations in taste perception.

What are common challenges in working with recombinant TAS2R38 and how can they be addressed?

Working with bitter taste receptors like TAS2R38 presents several technical challenges:

  • Membrane protein expression: As a G protein-coupled receptor, TAS2R38 can be difficult to express at high levels. Solution: Optimize codon usage for the expression system and consider adding chaperon molecules.

  • Protein solubility: Membrane proteins often have solubility issues. Solution: Use appropriate detergents during purification and consider adding stabilizing agents like glycerol in the storage buffer.

  • Functional reconstitution: Maintaining receptor functionality during purification is challenging. Solution: For functional studies, use cell-based assays rather than working with purified protein.

  • Variable responsiveness: Different TAS2R38 variants show variable responses to bitter compounds. Solution: Include well-characterized positive and negative controls when testing novel variants .

How can researchers validate the authenticity and activity of recombinant TAS2R38?

To ensure the quality and functionality of recombinant TAS2R38:

  • Sequence verification: Confirm the coding sequence matches the expected variant

  • Protein expression validation: Use Western blot with anti-tag antibodies to verify expression and correct size

  • Subcellular localization: Confirm membrane localization using immunofluorescence or cell-surface biotinylation assays

  • Functional validation: Perform calcium imaging assays with known agonists like PTC

  • Dose-response analysis: Generate dose-response curves to calculate EC50 values and compare with published values for the same variant

These validation steps ensure that any observed functional differences can be attributed to genuine receptor properties rather than technical artifacts.

What emerging technologies might enhance TAS2R38 research?

Several cutting-edge approaches have potential to advance TAS2R38 research:

  • CRISPR/Cas9 genome editing: Creating precise mutations in endogenous TAS2R38 genes to study function in cellular models

  • Single-cell RNA sequencing: Analyzing expression patterns of TAS2R38 and associated signaling components in taste receptor cells

  • Cryo-EM structural studies: Determining the three-dimensional structure of TAS2R38 to understand the molecular basis of ligand binding and receptor activation

  • Computational modeling: Using molecular dynamics simulations to predict how sequence variations affect receptor structure and ligand interactions

  • Organoid models: Developing taste bud organoids to study TAS2R38 function in a more physiologically relevant context

These technologies could provide unprecedented insights into the molecular mechanisms of bitter taste perception mediated by TAS2R38.

How might TAS2R38 research contribute to broader understanding of evolutionary biology?

TAS2R38 research offers valuable insights into several aspects of evolutionary biology:

  • Balancing selection: The maintenance of multiple functional variants in populations suggests evolutionary advantages to taste perception diversity

  • Local adaptation: Species-specific and population-specific TAS2R38 variants may reflect adaptations to regional plant toxins

  • Allopatric speciation: Studies of geographically isolated populations, such as the Sulawesi macaques, provide models for understanding how sensory perception evolves in separated populations

  • Gene-environment interactions: TAS2R38 variants may influence dietary preferences, potentially affecting nutritional intake and health outcomes

The evolutionary patterns observed in TAS2R38 may serve as models for understanding the evolution of other sensory receptors and their roles in ecological adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.