Recombinant Papio hamadryas Taste receptor type 2 member 39 (TAS2R39)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Activation Mechanisms

TAS2R39 is a non-selective bitter taste receptor activated by diverse ligands:

Agonists

  • Plant-derived compounds: Theaflavins, catechins (e.g., epigallocatechin gallate), and isoflavones (e.g., genistein) .

  • Peptides: Tryptophan-rich dipeptides (e.g., Trp-Trp) and tripeptides (e.g., Leu-Leu-Leu) .

Recombinant TAS2R39 is utilized in:

  • ELISA kits: Quantifying protein expression and ligand-binding assays .

  • Structural studies: Pharmacophore modeling to identify critical residues for ligand interaction (e.g., Tyr108, Ser267) .

  • Functional assays: Measuring Ca²⁺ flux or cAMP changes in response to bitter compounds .

Key Findings from Studies

  • Extraoral expression: Detected in baboon colon, respiratory tissues, and skin, suggesting roles beyond taste, such as toxin detection .

  • Dietary impact: Regulates enterohormones like GLP-1, linking bitter compound intake to appetite modulation .

  • Disease associations: Potential involvement in allergic rhinitis via cytokine stimulation .

Comparative Insights Across Species

While humans and baboons share conserved TAS2R39 functions, amphibians exhibit dramatic TAS2R gene expansion (e.g., 178 receptors in Ra. catesbaiana), highlighting evolutionary adaptations for ecological toxin avoidance . Baboon TAS2R39 retains ligand specificity similar to humans, making it a viable model for translational studies .

Challenges and Future Directions

  • Low expression: TAS2R39 is minimally expressed in tissues, complicating detection .

  • Therapeutic potential: Targeting TAS2R39 could modulate metabolic or inflammatory pathways, but selective agonists/antagonists remain scarce .

Ongoing research focuses on high-throughput screening to identify novel ligands and cryo-EM studies to resolve its full 3D structure .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TAS2R39; Taste receptor type 2 member 39; T2R39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MLGRCFPPNTKEKQQLRMIKLCDPAESELSPFLITLTLAVLLAEYLTGIIANGFITAIHA AECVQNKSVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDTVYYAFKISFIFL NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRISGLIPWLLWLSVFISFSHSMFCINIC TGYCDNSFPIHSSNSTEKTYFSEISVVSLAFFFNLGIVIPLIMFILAAILLILSLKRHTL YMXSNATGSKDPSMEAHIGAIKATSYFLILYIFNAVALFIYLSNMFDINSLWNTLCQIIM AAYPASHSILLIKDNPGLRRAWKQLQHRLHLYPKEWTL
Uniprot No.

Target Background

Function

Recombinant Papio hamadryas Taste receptor type 2 member 39 (TAS2R39) is a receptor potentially involved in bitterness perception and is linked to gustducin. It may contribute to sensing gastrointestinal chemical composition. Activation of this receptor may stimulate alpha-gustducin, mediate PLC-beta-2 activation, and subsequently gate TRPM5.

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R39 and what is its primary function?

TAS2R39 is a member of the bitter taste receptor family (TAS2Rs), which are G protein-coupled receptors. The primary evolutionary role of TAS2R39 is to sense bitter components in food and protect organisms from potentially harmful compounds. Beyond taste sensation, it has been implicated in regulating enterohormones and food intake in the gastrointestinal system and may be involved in allergic rhinitis and inflammatory processes in the respiratory system . As a relatively non-selective receptor, TAS2R39 can be activated by various plant-derived compounds including theaflavins, catechins, and isoflavones .

What is known about the genetic structure of TAS2R39?

TAS2R39 is encoded by the TAS2R39 gene located on chromosome 7 (7q34) in humans. Interestingly, this gene contains no introns, classifying it as an intron-less or single-exon gene . This structural characteristic is significant for researchers designing expression systems or performing genetic manipulations. The absence of introns simplifies cloning procedures and reduces potential variability in transcript processing.

How does the Papio hamadryas (baboon) TAS2R39 compare to human TAS2R39?

The Papio hamadryas TAS2R39 protein consists of 338 amino acids, which matches the length of human TAS2R39 . While complete comparative analyses are still developing, both proteins share the seven-transmembrane domain structure characteristic of GPCRs. When working with the baboon recombinant protein, researchers should consider potential species-specific differences in ligand binding properties, although there is evidence that many compounds elicit responses from TAS2Rs across species .

What tissues express TAS2R39 and how can researchers detect its expression?

TAS2R39 has been detected in multiple tissues beyond the oral cavity. Expression has been identified in:

Tissue/Cell TypeDetection MethodExpression LevelReference
Oral tissuesRT-PCRLow relative to other TAS2Rs
ColonGene expression analysisLow
BronchiGene expression analysisLow
Nasal mucosaGene expression analysisLow
ArteriesGene expression analysisLow
SkinGene expression analysisLow
Intestinal cells (HuTu-80, NCI-H716)Cell line studiesDetectable
Myometrial cells (hTERT-HM)Cell line studiesDetectable
Lung macrophagesCell line studiesDetectable
Choroid plexusProtein detectionDetectable
Pancreas, spleen, brain, testes, ovariesDatabase annotationLow

For detection, researchers typically use RT-PCR for gene expression, while antibody-based methods (immunohistochemistry, Western blot) can be used for protein detection. Due to the generally low expression levels, sensitive detection methods are recommended, possibly including qPCR with optimization for low-abundance transcripts .

What expression systems are suitable for producing recombinant TAS2R39?

E. coli expression systems have been successfully used to produce recombinant TAS2R39 proteins, as evidenced by the commercially available Papio hamadryas TAS2R39 with an N-terminal His tag . When designing expression constructs, researchers should consider:

  • Codon optimization for the chosen expression system

  • Inclusion of appropriate tags (His tag is commonly used) for purification and detection

  • Signal peptide inclusion/exclusion based on experimental needs

  • Membrane protein expression challenges, potentially requiring detergents or specialized host cells

For functional studies requiring properly folded and membrane-integrated protein, mammalian or insect cell expression systems may be preferable to bacterial systems .

What is known about the structure of TAS2R39 and its binding mechanisms?

TAS2R39 has seven transmembrane domains (numbered I to VII), typical of G protein-coupled receptors. Computer modeling suggests that the binding pocket is located extracellularly between transmembrane helices III, V, VI, and VII . The binding interactions primarily involve:

  • Hydrophobic interactions covering most of the binding surface

  • Hydrogen bond acceptors and donors contributing to binding

  • Potential π-π aromatic influences in the binding pocket

Structural differences between agonists and antagonists have been identified: antagonists lack a hydrogen donor and display stereochemical flexibility that fills the binding pocket, preventing conformational changes necessary for receptor activation .

What are the known agonists and antagonists for TAS2R39?

TAS2R39 interacts with numerous compounds, with varying degrees of specificity:

Specific TAS2R39 Agonists:

  • Acetylgenistin

  • Genistin

  • Glycitin

  • Malonyl genistin

  • Acacetin

  • 5,2′-dihydroxyflavone

  • Gardenin A

  • Genkwanin gossypetin

  • 6-methoxyflavonol

  • 4′-hydroxyflavanone

TAS2R39 Antagonists:

  • 6,3'-dimethoxyflavanone (strong inhibition)

  • 4'-fluoro-6-methoxyflavanone (strong inhibition)

  • 6-methoxyflavanone (weaker inhibition)

For antagonists, a methoxy group on position 6 of the A ring is required, along with the absence of a double bond in the C ring .

How can researchers use structure-activity relationships to design experiments with TAS2R39?

When designing experiments investigating TAS2R39-ligand interactions, researchers should consider:

  • The importance of glycosylation: Glycosylation reduces but does not eliminate TAS2R39 activation (higher agonist concentrations required)

  • C-ring skeletal structure: Alterations affect potency and efficacy but not activation ability

  • Substituent requirements: Hydroxy group substitutions are necessary for TAS2R39 binding

  • Cross-reactivity: Many compounds activate multiple TAS2Rs, requiring careful controls in functional studies

When studying structure-activity relationships, systematic modifications of known ligands (particularly plant-derived compounds like theaflavins, catechins, and isoflavones) combined with functional assays can yield valuable insights .

What functional assays are appropriate for studying TAS2R39 activity?

Researchers can employ several approaches to study TAS2R39 function:

  • Calcium mobilization assays: As a GPCR, TAS2R39 activation leads to intracellular calcium release, which can be measured using fluorescent calcium indicators (Fluo-4, Fura-2) in transfected cells expressing the receptor

  • Reporter gene assays: Systems coupling receptor activation to reporter gene expression (luciferase, GFP) allow for quantitative assessment of activation

  • Electrophysiological methods: Patch-clamp recordings can detect channel activities downstream of TAS2R39 activation

  • Co-immunoprecipitation: For identifying protein-protein interactions in the signaling pathway

  • Binding assays: Using labeled ligands to determine binding affinities and kinetics

When performing these assays with recombinant Papio hamadryas TAS2R39, researchers should reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, potentially with 5-50% glycerol addition for stability .

How should researchers handle and store recombinant TAS2R39 protein for optimal experimental results?

For optimal results with recombinant Papio hamadryas TAS2R39:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Consider adding 5-50% glycerol for stability

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • The protein is supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Protein quality can be verified using SDS-PAGE, with purity greater than 90% expected for commercial preparations .

How can TAS2R39 research contribute to understanding extraoral chemosensory systems?

TAS2R39 presents valuable opportunities for investigating extraoral chemosensation because:

  • It is expressed in multiple tissues beyond the oral cavity, including the respiratory, gastrointestinal, and reproductive systems

  • It may function as a chemical sensor in the gut and airways, mediating responses to nutrients and inhaled substances

  • Evidence suggests it can detect bacterial quorum sensing molecules, potentially contributing to microbiome-host interactions

  • It may participate in immune responses in the airways

Researchers investigating these phenomena should design tissue-specific expression systems and functional assays relevant to the physiological context. For example, studies in gut epithelial cells might focus on hormone release, while respiratory tissue studies could examine mucus secretion or ciliary beating .

What is the current understanding of TAS2R39's role in disease processes?

Research on TAS2R39's involvement in pathological conditions is still emerging, but several directions show promise:

  • Respiratory diseases: TAS2R39 may be involved in the congestion process of allergic rhinitis and stimulation of inflammatory cytokines

  • Metabolic regulation: Through its potential influence on enterohormones, TAS2R39 may affect food intake and metabolic regulation

  • Pathogen detection: Its ability to detect compounds from microorganisms suggests a role in host-pathogen interactions

Researchers investigating these connections should consider tissue-specific knockdown/knockout approaches, receptor-specific antagonists, or agonist treatments in relevant disease models .

How conserved is TAS2R39 across species and what does this suggest about its evolutionary significance?

Comparative studies of TAS2Rs across species reveal several important patterns:

  • Many agonists that activate human TAS2Rs also activate non-human TAS2Rs, suggesting functional conservation despite dietary variation

  • Some compounds elicit responses from TAS2Rs in every species tested to date, indicating evolutionarily conserved detection mechanisms

  • The conservation may reflect the limited chemical diversity of plant defense compounds, which tend to fall into chemical families (alkaloids, terpenes, phenolics)

When designing comparative studies with Papio hamadryas TAS2R39, researchers should consider functional assays that evaluate responses to a broad panel of bitter compounds across multiple species. This approach can reveal evolutionary patterns in chemosensory adaptations .

What methodological approaches are recommended for functional comparison of TAS2R39 across species?

For researchers conducting cross-species functional comparisons:

  • Expression normalization: Ensure comparable expression levels across species-specific receptors in heterologous systems

  • Dose-response curves: Generate complete dose-response relationships rather than single-concentration responses

  • Ligand diversity: Test structurally diverse compounds to comprehensively characterize receptor properties

  • Phylogenetic analysis: Interpret functional differences in the context of evolutionary relationships

  • Chimeric receptors: Create chimeras between species variants to identify domains responsible for functional differences

The amino acid sequence provided for Papio hamadryas TAS2R39 (338 amino acids) offers a starting point for structural comparisons with human and other primate TAS2R39 proteins .

What are the most promising unexplored aspects of TAS2R39 biology?

Several research areas remain underdeveloped and offer significant potential:

  • Tissue-specific signaling pathways: How TAS2R39 couples to different downstream effectors in various tissues

  • Receptor trafficking and regulation: Mechanisms controlling receptor expression, localization, and turnover

  • Endogenous ligands: Identification of potential endogenous compounds that may activate TAS2R39

  • Interspecies variations in ligand specificity: Detailed comparisons of activation profiles across species

  • Heterodimer formation: Potential interactions with other GPCRs affecting signaling properties

  • Role in non-taste physiology: Deeper investigation of functions in immune response, hormone regulation, and other systems

What technical challenges must be overcome to advance TAS2R39 research?

Researchers face several methodological hurdles:

  • Low expression levels: TAS2R39 is expressed at low levels in most tissues, making detection challenging

  • Membrane protein difficulties: As a seven-transmembrane protein, structural studies and recombinant expression present technical challenges

  • Ligand promiscuity: Many compounds activate multiple TAS2Rs, complicating attribution of physiological effects

  • Lack of specific tools: Limited availability of highly specific antibodies and pharmacological tools

  • Physiological relevance: Connecting in vitro findings to in vivo significance requires innovative approaches

Addressing these challenges will require interdisciplinary approaches combining structural biology, molecular pharmacology, physiology, and computational modeling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.