Recombinant Papio hamadryas Taste receptor type 2 member 41 (TAS2R41)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

TAS2R41 belongs to the taste receptor type 2 (T2R) family, which comprises G-protein coupled receptors primarily responsible for bitter taste detection. In Papio hamadryas, the TAS2R41 gene encodes a protein of 307 amino acids in length . The gene is also known by the synonym T2R41, indicating its classification within the bitter taste receptor subfamily . As with other taste receptors, TAS2R41 plays a crucial role in the detection of specific bitter compounds, though the exact ligand specificity for the Papio hamadryas variant remains under investigation.

The protein exists as a transmembrane receptor, consistent with its function in taste sensation where it must interact with taste compounds in the oral cavity and subsequently trigger intracellular signaling cascades. The molecular weight and other physicochemical properties align with typical G-protein coupled receptors in this class, making it valuable for comparative studies across species.

Expression Systems

Recombinant Papio hamadryas TAS2R41 is primarily produced using cell-free expression systems, which offer advantages for membrane protein production including reduced toxicity issues and higher yield for difficult-to-express proteins . This approach bypasses the challenges often encountered when expressing membrane proteins in cellular systems, where protein folding and membrane insertion can create bottlenecks in production.

The cell-free expression system provides a controlled environment for protein synthesis, allowing for modifications and optimizations that might be necessary for proper folding and function of the receptor. This production method is particularly valuable for TAS2R41 and other taste receptors, which can be challenging to express in conventional systems due to their hydrophobic nature and multiple transmembrane domains.

Purification and Quality Control

Following expression, recombinant TAS2R41 undergoes purification processes to ensure high quality protein for research applications. The purified protein achieves a minimum of 85% purity as determined by SDS-PAGE (sodium dodecyl sulfate–polyacrylamide gel electrophoresis) . This analytical technique separates proteins based on their molecular weight, allowing for assessment of protein purity and integrity.

Quality control measures for recombinant TAS2R41 typically include:

Quality ParameterMethodSpecification
PuritySDS-PAGE≥85%
IdentityMass SpectrometryConfirmation of expected molecular weight
FunctionalityBinding assays (where applicable)Verification of ligand binding capability
Structural IntegrityCircular Dichroism or other spectroscopic methodsConfirmation of proper folding

These rigorous quality control measures ensure that the recombinant protein maintains its native structural features and functional capabilities, making it suitable for various research applications including structural studies, functional assays, and antibody production.

Variant Forms and Modifications

In addition to the full-length protein, partial forms of recombinant TAS2R41 are also available for specialized research applications . These partial constructs may focus on specific domains of interest, such as ligand-binding regions or G-protein interaction sites. Furthermore, recombinant TAS2R41 can be produced with various fusion tags to facilitate purification or detection, such as His-tags similar to those used with the related TAS2R4 protein .

These modifications and variants expand the utility of recombinant TAS2R41 in research settings, allowing scientists to focus on specific aspects of receptor structure or function. The availability of both full-length and partial constructs provides flexibility in experimental design based on the specific research questions being addressed.

TAS2R41 in Primate Evolution

The TAS2R41 gene has been identified in various primate species beyond Papio hamadryas, including humans, chimpanzees (Pan troglodytes), bonobos (Pan paniscus), gorillas (Gorilla gorilla gorilla), and orangutans (Pongo pygmaeus) . This conservation across primate species suggests fundamental roles in bitter taste perception that have been maintained throughout evolutionary history.

Comparative studies of TAS2R41 across these species provide insights into the evolution of taste perception in primates. Variations in the receptor sequence may reflect adaptations to different dietary patterns, environmental challenges, or selective pressures related to food selection and toxin avoidance. The availability of recombinant proteins from multiple species facilitates these comparative analyses.

Sequence Comparison with Other Species

Recombinant TAS2R41 is available from several species, allowing for comparative studies of structure and function. While the specific sequence similarities are not explicitly detailed in the search results, the conservation of this receptor across diverse species indicates its evolutionary significance.

The table below summarizes the species for which recombinant TAS2R41 is commercially available:

SpeciesScientific NameProduct Format
Hamadryas baboonPapio hamadryasFull-length and partial recombinant protein
HumanHomo sapiensFull-length and partial recombinant protein
ChimpanzeePan troglodytesFull-length recombinant protein
BonoboPan paniscusFull-length and partial recombinant protein
GorillaGorilla gorilla gorillaFull-length recombinant protein
OrangutanPongo pygmaeusPartial recombinant protein
MouseMus musculusFull-length and partial recombinant protein
RatRattus norvegicusFull-length and partial recombinant protein

This diversity of available recombinant proteins enables researchers to conduct cross-species comparisons, investigating evolutionary relationships and functional differences in bitter taste perception across mammals.

Functional Studies and Ligand Identification

One of the primary applications of recombinant TAS2R41 is in functional studies aimed at identifying specific bitter compounds (ligands) that activate this receptor. By expressing the recombinant protein in appropriate cellular systems, researchers can conduct high-throughput screening to identify natural or synthetic compounds that interact with TAS2R41. These studies contribute to our understanding of bitter taste perception mechanisms and may identify species-specific differences in taste sensitivity.

The identification of receptor-ligand interactions has implications beyond basic taste research. Bitter taste receptors have been identified in extra-oral tissues, suggesting potential roles beyond taste perception. Understanding these interactions may reveal novel physiological functions of TAS2R41 and related receptors in diverse biological contexts.

Evolutionary and Comparative Studies

Recombinant TAS2R41 from Papio hamadryas and other species serves as a valuable tool in evolutionary studies. Phylogenetic analyses incorporating TAS2R41 sequence data contribute to broader understanding of primate evolution and adaptation . The conservation of taste receptors across species reflects their fundamental importance in survival, as bitter taste perception generally serves as a warning system against potentially toxic compounds.

The study of TAS2R41 in phylogenetic contexts may reveal selection pressures related to dietary specialization, toxin avoidance, or other ecological factors that have shaped taste perception throughout evolutionary history. For instance, variations in TAS2R41 structure might correlate with dietary preferences or environmental exposures to specific bitter compounds in the habitats of different primate species.

Antibody Production and Immunological Applications

Recombinant TAS2R41 serves as an antigen for the production of specific antibodies, which are valuable tools for receptor localization, expression studies, and functional investigations . Both polyclonal and monoclonal antibodies against TAS2R41 enable researchers to detect the receptor in various tissues, quantify expression levels, and investigate regulatory mechanisms affecting receptor abundance.

These immunological applications extend the utility of recombinant TAS2R41 beyond functional studies, providing tools for investigating receptor expression patterns and regulation. Antibodies conjugated with various detection molecules (such as HRP or biotin) facilitate different experimental approaches, from Western blotting to immunohistochemistry and ELISA techniques .

Comparative Functional Analyses

The availability of recombinant TAS2R41 from multiple species enables comparative functional analyses to determine species-specific differences in ligand specificity, receptor sensitivity, or signaling efficiency. These studies could reveal how evolutionary processes have shaped taste perception across primate lineages and identify molecular adaptations related to dietary specialization or toxin avoidance.

Comparative analyses might focus on understanding how structural variations in TAS2R41 across species correlate with functional differences in bitter compound detection. Such investigations would contribute to broader understanding of the evolution of sensory systems and might reveal unexpected functions of this receptor family.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
TAS2R41; Taste receptor type 2 member 41; T2R41
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MQAALRAFFMLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILLSLGAFRFYLQL VGMGHNFYHSAHVVERSGVLTQQFFHLHWHFLNSVTFWFCSWLSVLFCVKIANITHPTFL WLKWRFPGWVPWLLLGSVLISFIIALLLFWVNYSAYQQFLIRTFSGNMTYEWNAMTEIYY FPFAQLVIWSIPCSVFLVSIXLLINSLRRHTWRMQHNSHSLQDPSTQAHTRALKFLISFL ILYVLSFLSLIIDGTKFISMQNDFYWPWQIAVYLSVSVHPFILIFNNLKLQSVFWQLLLL ARGFWVA
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is linked to gustducin. It could be involved in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.