Recombinant Papio hamadryas Taste receptor type 2 member 43 (TAS2R43)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Evolutionary Context

TAS2R43 is part of the bitter taste receptor family, which evolved to detect toxic or harmful compounds. In primates, TAS2R genes, including TAS2R43, have undergone tandem duplications and losses, shaping species-specific repertoires . For example:

  • Evolutionary Divergence: TAS2R genes in Cercopithecidae (a primate family including macaques and baboons) exhibit clade-specific duplications, suggesting dietary adaptations .

  • Functional Divergence: Amino acid substitutions in TAS2R genes can alter ligand binding, as seen in human TAS2R43 variants (e.g., W35S and H212R), which reduce receptor activity .

ELISA and Functional Assays

Recombinant Papio hamadryas TAS2R43 is used in ELISA kits to detect protein expression levels in biological samples . This tool enables:

  • Quantitative Analysis: Precise measurement of TAS2R43 in tissues or cell cultures.

  • Cross-Species Studies: Comparative analysis of bitter taste mechanisms between humans and non-human primates.

Human TAS2R43 as a Reference

Human TAS2R43 studies provide indirect insights into the Papio variant’s potential roles:

CompoundHuman TAS2R43 ResponseRelevance to Papio Studies
CaffeineActivated; linked to coffee preference May inform dietary adaptations in baboons.
GrosheiminActivated at high concentrations Potential ligand for Papio TAS2R43.
QuinineWeak activation Limited relevance to bitter perception.

Polymorphisms and Functional Impact

In humans, nonsynonymous SNPs in TAS2R43 (e.g., rs68157013, rs71443637) correlate with reduced receptor activity and altered bitter perception . Such polymorphisms highlight the receptor’s role in shaping individual and population-level dietary behaviors. While similar studies on Papio hamadryas are lacking, the recombinant protein facilitates experimental validation of these mechanisms.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R43; Taste receptor type 2 member 43; T2R43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MITFLPIIFSILVVVTFVIGNCANGFIALVNSTEWVKRQKISFADQILTALAVSRVGLLW VLLLNWYATVLNPAFYSVEVRTIVYNLWAVINHFSNWLATSLSIFYLLKIANFSNLIFLH LKRRVKSVVLVILLGPLLFLVCHLFVVNMNEIVRTKEYEGNMTWKSKLRSAMYLSNTTVT ILANLVPFILTLISFLLLICSLCKHLKKMQLRDKGSQDPSTKVHIKALQTVISLLLCVIY FLSIMISSWSLGRVENKAVFMFCKAIRFSYPSAHAFILIWGNKKLKQTLLSVLWNVRYCV KGQKLPSP
Uniprot No.

Target Background

Function
Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. Activated by the sulfonyl amide sweeteners saccharin and acesulfame K. In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency. May act as chemosensory receptors in airway epithelial cells to detect and eliminate potential noxious agents from the airways.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium membrane.

Q&A

What is TAS2R43 and what is its functional role in Papio hamadryas?

TAS2R43 belongs to the bitter taste receptor family, which plays a crucial role in preventing animals from ingesting potentially poisonous and harmful substances. In Papio hamadryas, as in other primates, these receptors are expressed in taste cells and help recognize bitter compounds in potential food sources. Functionally, TAS2R43 is involved in mediating responses to specific bitter compounds including aloin, saccharin, and acesulfame potassium, similar to its human ortholog . The receptor works through G-protein coupled signaling pathways that ultimately lead to calcium release and signal transduction, resulting in the perception of bitterness.

What are the common methods for expressing recombinant TAS2R43 in laboratory settings?

Expressing functional recombinant TAS2R43 requires specific methodological approaches to ensure proper membrane localization and signaling capability. The most effective method involves:

  • Incorporating an N-terminal signal sequence (such as rat somatostatin receptor type 3 (SST3) or rhodopsin (Rho) signal sequence) to promote receptor translocation to the plasma membrane

  • Co-expressing a G-protein chimera (typically Gα16-gust44) to couple receptor activation with phospholipase C activity

  • Including a reporter system such as mt-clytin II (a calcium-binding photoprotein) to detect receptor activation

For optimal expression, researchers should consider using a tricistronic vector system rather than co-transfection of multiple plasmids to ensure consistent expression levels of all components in the same cells, which significantly improves assay reproducibility .

What are the most effective functional assays for characterizing recombinant Papio hamadryas TAS2R43?

Bioluminescence-based calcium release assays represent the gold standard for functional characterization of recombinant TAS2R43. This methodology offers several advantages over fluorescence-based approaches:

  • Higher signal-to-noise ratio, providing a larger assay window

  • Better performance when evaluating ligands within autofluorescent matrices

  • Greater sensitivity for detecting subtle differences in receptor activation

The assay setup requires:

  • Cells expressing the receptor with appropriate N-terminal signal sequence

  • Gα16-gust44 chimera for coupling to phospholipase C

  • Mitochondrial-targeted calcium-binding photoprotein (mt-clytin II)

When implementing this assay, researchers should optimize transfection conditions and test multiple N-terminal signal sequences, as studies have shown that the M3 receptor signal sequence can sometimes provide better functional expression than the traditional SST3 tag for certain TAS2Rs .

How can researchers identify functionally important polymorphic sites in TAS2R43?

Identifying functionally important polymorphic sites in TAS2R43 requires a multi-faceted approach:

  • Computational prediction tools: While tools like SIFT and PolyPhen-2 can identify potentially harmful nonsynonymous mutations, they have limitations. These tools may miss important functional sites, as evidenced by their failure to detect known functional polymorphisms in other TAS2Rs .

  • Cross-species comparative analysis: Examining sequence conservation across primate species can highlight evolutionarily constrained residues likely to be functionally important.

  • Functional validation: Site-directed mutagenesis followed by calcium mobilization assays is essential to confirm the functional impact of candidate polymorphisms.

  • Structural modeling: Newer computational tools like AlphaFold can predict three-dimensional structures, helping to identify residues in ligand-binding pockets or receptor activation domains .

It's important to note that functional effects may emerge from site-site interactions rather than individual residues, necessitating comprehensive mutagenesis studies covering multiple positions simultaneously.

What experimental design considerations are critical when comparing TAS2R43 function across primate species?

When designing comparative studies of TAS2R43 across primate species, researchers should address several critical factors:

  • Expression system standardization: Use identical expression systems, vector constructs, and assay conditions for all species variants to minimize technical variability.

  • Signal sequence optimization: Different primate TAS2R43 orthologs may require species-specific N-terminal signal sequences for optimal cell surface expression. Screen multiple signal sequences (e.g., SST3, Rho, M3) to determine the optimal tag for each ortholog .

  • Ligand panel selection: Test responses to a diverse panel of bitter compounds, including those reflecting ecological niches of the species being compared.

  • Dose-response relationships: Generate complete dose-response curves rather than single-concentration measurements to accurately compare EC50 values and efficacy parameters.

  • Normalization controls: Include internal expression controls to account for potential differences in expression levels between orthologs.

  • Statistical power analysis: Ensure sufficient biological and technical replicates based on preliminary data variability to detect biologically meaningful differences.

How has TAS2R43 evolved across primate lineages and what does this reveal about dietary adaptations?

The evolution of TAS2R43 across primate lineages reflects dietary adaptations to different ecological niches. Bitter taste perception plays a crucial role in preventing the ingestion of potentially toxic plant compounds, particularly relevant for herbivorous and omnivorous primates .

Analysis of TAS2R genes across primates shows variable patterns of selection and diversity. In humans, TAS2R43 exhibits moderate diversity with known functional polymorphisms affecting responses to aloin, saccharin, and acesulfame potassium . This diversity likely reflects relaxed selective constraints in recent human evolution, potentially due to reduced dependence on bitter taste for toxin avoidance as humans developed cultural and cognitive strategies for food selection .

Comparative studies between human and non-human primate TAS2Rs suggest that:

  • Cercopithecidae species (including Papio) that primarily feed on plants may have experienced stronger selection on bitter taste receptor genes

  • The ability to detect plant-derived bitter compounds likely served as a driving force for TAS2R evolution in herbivorous primates

  • Species-specific duplications of certain TAS2R genes (like those observed in Papio anubis) may represent adaptations to specific dietary challenges

A detailed evolutionary analysis would require sequencing and functional characterization of TAS2R43 across multiple primate species, followed by tests for signatures of selection.

What is the nucleotide diversity profile of TAS2R43 compared to other TAS2R genes?

Based on human TAS2R diversity data, we can infer general patterns that may apply to primate TAS2Rs:

Across the human TAS2R family, nucleotide diversity (π) ranges from 0.005% to 0.358%, with an average of 0.12% . While specific data for Papio hamadryas TAS2R43 is not provided in the search results, human TAS2R43 exhibits functional polymorphisms that affect responses to multiple bitter compounds .

The differentiation between populations (FST) for human TAS2R genes ranges from 0.01 to 0.26 with a mean of 0.13, indicating modest differentiation . Most TAS2R genes, including TAS2R43, show diversity patterns consistent with neutral expectations, falling between the 5th and 95th percentiles of genome-wide distributions .

Notably, two TAS2R genes (TAS2R20 and TAS2R42) show unusually high diversity (above the 95th percentile), while one (TAS2R39) shows unusually low diversity (below the 5th percentile) . This variation in diversity profiles suggests different evolutionary pressures across the TAS2R family.

How do functional constraints on TAS2R43 compare between humans and non-human primates?

While the search results don't provide specific comparative data between human and Papio hamadryas TAS2R43, we can infer several patterns based on general TAS2R evolution:

To definitively establish these differences, comparative functional studies using recombinant receptors from both species would be necessary, testing responses to ecologically relevant bitter compounds.

What are the common challenges in expressing functional recombinant TAS2R43 and how can they be overcome?

Researchers face several challenges when expressing functional TAS2R43:

  • Poor cell surface trafficking: TAS2Rs often exhibit poor trafficking to the plasma membrane in heterologous systems.

    • Solution: Use optimized N-terminal signal sequences. While SST3 and Rho tags have been traditionally used, screening alternative signal sequences from other GPCRs can significantly improve surface expression. For some TAS2Rs, the M3 receptor signal sequence has shown superior performance .

  • Inconsistent co-expression of multiple components: Traditional approaches using co-transfection of separate vectors for the receptor, G-protein chimera, and reporter lead to heterogeneous cell populations.

    • Solution: Implement a tricistronic vector system that ensures uniform expression of all three components in the same cells, dramatically improving assay reproducibility .

  • Post-translational modifications: Proper glycosylation is important for TAS2R trafficking.

    • Solution: Ensure conservation of the consensus N-glycosylation site in the second extracellular loop, which has been shown to be important for receptor cell surface expression .

  • Low signal-to-noise ratio in functional assays:

    • Solution: Employ bioluminescence-based calcium release assays rather than fluorescence-based methods, as they provide larger assay windows and function better with autofluorescent compounds .

How can researchers address the issue of species-specific differences in TAS2R43 pharmacology?

Addressing species-specific differences in TAS2R43 pharmacology requires a systematic approach:

  • Comprehensive ligand screening: Test a diverse panel of bitter compounds against both human and Papio hamadryas TAS2R43 to identify differences in ligand specificity and potency.

  • Chimeric receptor approach: Generate chimeric receptors by swapping domains between human and baboon TAS2R43 to identify regions responsible for species-specific pharmacological differences.

  • Site-directed mutagenesis: Once candidate regions are identified, perform targeted mutagenesis of specific residues to pinpoint key amino acids responsible for pharmacological differences.

  • Homology modeling and docking simulations: Utilize structural prediction tools to model the binding pockets of both receptors and simulate ligand docking to identify structural determinants of species differences.

  • Validation with naturally occurring variants: If available, test naturally occurring variants of TAS2R43 from different baboon populations to assess intra-species variability in pharmacological properties.

This methodical approach can elucidate the molecular basis for species-specific differences in TAS2R43 pharmacology, providing insights into evolutionary adaptations to different dietary environments.

What quality control measures are essential when working with recombinant TAS2R43?

To ensure reliable results when working with recombinant TAS2R43, researchers should implement these quality control measures:

  • Expression verification: Confirm proper expression using:

    • Western blotting with epitope tags (if incorporated)

    • Flow cytometry to quantify surface expression levels

    • Immunofluorescence microscopy to verify membrane localization

  • Functional validation: Verify receptor functionality using:

    • Dose-response curves with known agonists

    • Calcium mobilization assays with positive and negative controls

    • Comparison to reference standards if available

  • Sequence verification: Confirm the entire coding sequence to ensure no unwanted mutations were introduced during cloning.

  • Glycosylation assessment: Verify proper post-translational modifications, particularly glycosylation of the conserved site in the second extracellular loop.

  • Batch consistency checks: When preparing multiple batches of cells or receptors, implement consistency checks to ensure comparable expression levels and functional responses.

  • Signal-to-background ratio monitoring: Establish minimum acceptable signal-to-background ratios for functional assays and monitor this parameter across experiments.

  • Positive control inclusion: Always include a well-characterized TAS2R (such as human TAS2R38 with known ligands) as a positive control in experimental setups.

How might emerging computational methods advance our understanding of TAS2R43 structure and function?

Emerging computational methods offer promising avenues for advancing TAS2R43 research:

  • AI-based structure prediction: Tools like AlphaFold have revolutionized protein structure prediction and can provide detailed models of TAS2R43's three-dimensional structure without crystallographic data . These models can identify potential ligand-binding pockets and conformational changes associated with activation.

  • Molecular dynamics simulations: Once structural models are available, molecular dynamics simulations can reveal dynamic aspects of receptor-ligand interactions and conformational changes that occur during receptor activation.

  • Advanced computational ligand screening: Virtual screening of compound libraries against TAS2R43 structural models can identify novel ligands and potential pharmacological modulators.

  • Network analysis of receptor-effector interactions: Systems biology approaches can model how TAS2R43 interacts with downstream signaling components, providing insights into signal amplification and integration.

  • Evolutionary sequence analysis: Sophisticated phylogenetic methods can trace the evolutionary history of TAS2R43 across primate lineages, identifying episodes of positive selection or functional constraint.

These computational approaches, when combined with experimental validation, can significantly accelerate our understanding of TAS2R43 structure, function, and evolution.

What are the potential applications of TAS2R43 research beyond taste perception?

TAS2R43 research extends beyond basic taste perception into several promising application areas:

  • Extraoral bitter taste receptor functions: TAS2Rs are expressed in multiple tissues beyond the tongue, including airways, gut, and other organs. Research into Papio hamadryas TAS2R43 may provide comparative insights into these extraoral functions.

  • Drug discovery platforms: Understanding the pharmacology of TAS2R43 across species can inform the development of bitter taste blockers or modulators with potential therapeutic applications.

  • Evolutionary medicine: Comparative studies between human and non-human primate TAS2R43 can illuminate how dietary adaptations have shaped sensory perception, with implications for modern human diet-related diseases.

  • Agricultural applications: Knowledge of bitter taste receptor mechanisms across species can inform the development of deterrents for crop protection or strategies to reduce bitterness in food products.

  • Biosensors and diagnostic tools: Engineered TAS2R43-based biosensors could potentially detect specific bitter compounds in environmental or biological samples.

Future research exploring these diverse applications will require interdisciplinary collaboration between evolutionary biologists, structural biologists, pharmacologists, and biomedical researchers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.