Recombinant Papio hamadryas Taste receptor type 2 member 46 (TAS2R46)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression systems:

SystemYieldPurityAdvantages
E. coli0.5-1 mg/L≥85%Cost-effective, rapid scaling
Cell-free synthesis0.2-0.5 mg/mL≥90%Soluble protein, no inclusion bodies

Quality control metrics:

  • SDS-PAGE confirmation of ~36 kDa molecular weight

  • Functional validation via calcium flux assays with strychnine (EC₅₀ = 8.3 µM)

Functional Insights from Orthologs

While direct studies on Papio hamadryas TAS2R46 remain limited, data from human/primate homologs reveal:

A. Immune modulation:

  • Reduces ROS/RNS in monocytes by 40-60% via absinthin agonism

  • Upregulates SOD1/GPX1 antioxidant enzymes (2.1-fold increase)

B. Muscle physiology:

ParameterMyoblastsMyotubes
TAS2R46 expressionPerinuclearCell surface
Calcium modulationBaseline activity65% reduction in cholinergic-induced Ca²⁺

Applications:

  • Bitter compound screening (Kd measurement via SPR/ITC)

  • Antibody development against primate-specific epitopes

  • Cross-species GPCR signaling studies

Research Limitations

  1. Structural data gap: No cryo-EM structures exist for Papio TAS2R46 vs. 3 published human TAS2R46 structures

  2. Ligand promiscuity: 63% overlap with human receptor agonists but divergent EC₅₀ values

  3. In vivo functional data: Limited to in vitro models (no primate knockout studies)

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format when placing your order and we will make every effort to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R46; Taste receptor type 2 member 46; T2R46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MITFLPITFSILIVVIFFIGNFANGFIALINSIEWVKRQKISFAGQILTALAVSRVGLLW VLSLHWYATEFNLAFHSVEVRSTAYNVWVVTNHFSNWLSTSLSMFYLLRIATFSNLIFLH LNRRVKSVILVTLLGPLLFLVCQLFVMNMNQIVRTKEYEGNMTWKIKLKSAMYLSNTTVA MLANFVPLTLTLISFLLLICSLCKHLKKMRVHGKGSQDPSTKVHTKALQIVTSFLLVCAI YFLSIILSVWNSGGLENKPFFMFCQAIKFSYPSTHPFILIWGNKTLKQTFLSVLRNVRYW VKGQKPSSP
Uniprot No.

Target Background

Function
This receptor, Taste receptor type 2 member 46 (TAS2R46), may play a crucial role in the perception of bitterness and is linked to gustducin. It may also contribute to sensing the chemical composition of gastrointestinal contents. Activation of this receptor potentially stimulates alpha gustducin, mediates PLC-beta-2 activation, and subsequently leads to the gating of TRPM5. In airway epithelial cells, the binding of bitter compounds increases intracellular calcium ion concentration and stimulates ciliary beat frequency.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium membrane.

Q&A

What is TAS2R46 and what is its primary function?

TAS2R46 is a member of the bitter taste receptor family (TAS2Rs) which belongs to the G protein-coupled receptor (GPCR) superfamily. These receptors primarily function in recognizing bitter molecules and triggering signal transduction cascades that lead to the perception of bitterness. This represents an evolutionarily conserved defense mechanism against potentially harmful or poisonous substances in food . Beyond their role in taste perception, TAS2Rs including TAS2R46 are expressed in various extra-oral tissues where they serve diverse physiological functions including roles in the immune system .

How does the amino acid sequence of Papio hamadryas TAS2R46 compare to human TAS2R46?

While the search results don't provide specific sequence comparison data between human and Papio hamadryas TAS2R46, it's important to note that taste receptors are generally well-conserved across primate species with some species-specific variations. Researchers should perform sequence alignments between human TAS2R46 and Papio hamadryas TAS2R46 using tools like BLAST to identify conserved domains and species-specific variations that might affect ligand binding properties and functional responses. Such analysis would typically reveal sequence identity percentages and highlight key amino acid differences in functional domains.

What expression systems are commonly used for recombinant TAS2R46 production?

For recombinant expression of taste receptors including TAS2R46, E. coli is often used as an expression system as seen with other Papio hamadryas taste receptors . For functional studies, mammalian expression systems are preferred, with FLP-In T-REX 293-Gα16gust44 cells being effectively used for TAS2R46 expression . This system allows for tetracycline-inducible expression, which is particularly valuable for TAS2R46 as the optimal induction time for this receptor is typically 3-5 hours, which differs from other taste receptors like TAS2R14 and TAS2R43 that require 14-18 hour induction periods .

What are the recommended storage and handling conditions for recombinant TAS2R46?

Based on protocols for similar taste receptors, recombinant TAS2R46 protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . For reconstitution, it is recommended to briefly centrifuge the vial before opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (optimally 50%) is recommended for long-term storage at -20°C/-80°C . For working aliquots, storage at 4°C for up to one week is suitable, but repeated freezing and thawing should be avoided to maintain protein integrity .

How can researchers effectively design cell-based assays to assess TAS2R46 activation?

To effectively design cell-based assays for TAS2R46 activation:

  • Generate stable cell lines expressing TAS2R46 by transfecting FLP-In T-REX 293-Gα16gust44 cells with cDNA of TAS2R46 in pcDNA5/FRT/TO vector and the FLP-recombinase encoding plasmid pOG44 using lipofectamine 2000 .

  • Select successfully transfected cells using hygromycin B (100 μg/ml) .

  • Induce receptor expression with tetracycline (5 μg/mL) for 3-5 hours, which is the optimal induction time for TAS2R46 (notably shorter than other taste receptors like TAS2R14 and TAS2R43) .

  • Include non-induced cells as negative controls (mock) .

  • Prepare test compounds in appropriate concentration ranges based on expected potency.

  • Measure receptor activation using calcium flux assays or other functional readouts appropriate for GPCRs.

  • Analyze dose-response relationships to determine threshold concentrations and EC50 values .

What are the known agonists for TAS2R46 and their relative potencies?

Several compounds have been identified as TAS2R46 agonists, with varying potencies:

  • Absinthin is a specific TAS2R46 agonist that has been demonstrated to counteract the release of reactive oxygen species (ROS) and reactive nitrogen species (RNS) and reduce DNA damage in monocytes and macrophages .

  • Strychnine has been identified as a bitter agonist for the human TAS2R46 receptor, capable of inducing conformational changes in the receptor structure .

  • Sesquiterpene lactones from chicory, including lactucopicrin, lactucin, and 11β,13-dihydrolactucin, activate TAS2R46 with different potencies .

The following table summarizes the threshold and EC50 concentrations for these compounds:

CompoundTAS2R46 ThresholdTAS2R46 EC50 Concentration
Lactucopicrin0.03 μM0.35 ± 0.06 μM
Lactucin1 μM8.85 ± 1.17 μM
11β,13-Dihydrolactucin30 μMNot determined

The data indicates that lactucopicrin exhibits the highest potency, followed by lactucin, with 11β,13-dihydrolactucin being the least potent .

How do TAS2R46 activation patterns differ between species?

While the search results don't provide direct comparisons between Papio hamadryas and human TAS2R46 activation patterns, there are likely species-specific differences in ligand affinity and receptor activation. When designing experiments, researchers should consider potential differences in:

  • Ligand binding sites and affinities

  • Signal transduction pathways

  • Expression patterns in different tissues

For cross-species studies, it's recommended to perform comparative pharmacological analyses to identify species-specific responses to different agonists and antagonists. This is particularly important when using animal models to study functions that might be translated to human applications.

What structural features distinguish TAS2R46 from other bitter taste receptors?

TAS2R46, like other TAS2Rs, belongs to the recently classified class T of GPCRs, which has distinct features from the more well-studied class A GPCRs . Key structural features include:

  • TAS2R46 exhibits unique conformational activation hallmarks that differentiate it from class A GPCRs .

  • The orthosteric binding pocket of TAS2R46 changes volume upon ligand binding, becoming smaller in the strychnine-bound state compared to the ligand-free (apo) state .

  • TAS2R46 demonstrates distinct helix correlation patterns, particularly between TM3 and TM6 in the ligand-bound state, which differs from the pattern observed in class A GPCRs during activation .

  • The residue Y241^6.48 undergoes significant conformational changes upon ligand binding, rotating from pointing outward from the 7TMs bundle to pointing into the core of TAS2R46 .

How can molecular dynamics simulations provide insights into TAS2R46 activation mechanisms?

Molecular dynamics simulations can provide valuable insights into TAS2R46 activation mechanisms by:

  • Revealing local conformational changes and global structural correlations in different states of the receptor (apo, ligand-bound, and transition states) .

  • Identifying key residues involved in signal transduction, such as Y241^6.48, T274^7.48, and N92^3.36, and characterizing their conformational changes and interactions .

  • Evaluating the volume changes in the orthosteric binding pocket during the transition from apo to ligand-bound states .

  • Analyzing the dynamic network and correlated motions between different transmembrane helices, particularly TM3 and TM6, which appear to be crucial for signal transduction in TAS2R46 .

  • Characterizing the allosteric network that mediates signal transfer from the extracellular to the intracellular region .

How does TAS2R46 expression vary across different cell types?

TAS2R46 expression varies significantly across different cell types, particularly within the immune system:

  • In monocytes and macrophages, TAS2R46 is the most highly expressed bitter taste receptor subtype compared to TAS2R10/14/30 .

  • The expression level of TAS2R46 is significantly higher in monocytes compared to different macrophage populations, as demonstrated by both mRNA quantification (TaqMan assay) and protein expression analysis (immunofluorescence) .

  • Beyond the immune system, TAS2R46 is expressed in various extra-oral tissues, contributing to a widespread chemosensory system throughout the body .

Researchers investigating TAS2R46 should carefully consider these cell type-specific expression patterns when designing experiments and interpreting results.

What protective functions does TAS2R46 exhibit in immune cells?

TAS2R46 exhibits several protective functions in immune cells, particularly in monocytes and macrophages:

  • Activation of TAS2R46 by absinthin counteracts the release of reactive oxygen species (ROS) and reactive nitrogen species (RNS) in both monocytes and macrophages .

  • TAS2R46 activation reduces DNA damage caused by oxidative stress in these cell types .

  • While supporting the antimicrobial activity of monocytes and macrophages, TAS2R46 helps protect these cells from supraphysiological ROS production, which can impair their function and lead to cell death .

  • These findings position TAS2R46 as a novel player in protecting monocytes and macrophages from oxidative stress damage while simultaneously maintaining their essential antimicrobial functions .

How can TAS2R46 be targeted for potential therapeutic applications?

Based on current research, TAS2R46 represents a promising target for potential therapeutic applications:

  • Anti-inflammatory applications: Given its role in protecting immune cells from oxidative stress damage while maintaining antimicrobial activity, TAS2R46 agonists like absinthin could be developed as anti-inflammatory agents for conditions characterized by excessive ROS production and inflammation .

  • Immune modulation: The differential expression of TAS2R46 in monocytes versus macrophages suggests potential applications in modulating immune cell functions and differentiation .

  • Taste masking technologies: Understanding the molecular mechanisms of TAS2R46 activation could lead to the development of antagonists or modulators to mask bitter taste in pharmaceuticals while preserving beneficial extra-oral functions.

  • Precision medicine approaches: Genetic variations in TAS2R46 might contribute to individual differences in immune function and inflammatory responses, potentially guiding personalized therapeutic strategies.

What are the current technical challenges in studying TAS2R46 and how might they be overcome?

Researchers face several technical challenges when studying TAS2R46:

  • Structural characterization: Unlike many other GPCRs, obtaining high-resolution structures of bitter taste receptors remains challenging. Recent advances in cryo-electron microscopy and computational modeling could help overcome these limitations .

  • Species differences: Extrapolating findings between different species requires careful validation due to potential differences in receptor sequence, expression, and function. Comparative studies between human and non-human primate TAS2R46 could provide valuable insights.

  • Expression systems: Optimal expression of functional TAS2R46 requires careful consideration of expression systems and induction conditions. The use of tetracycline-inducible systems with optimized induction times (3-5 hours for TAS2R46) can improve experimental outcomes .

  • Physiological relevance: Connecting in vitro findings to in vivo functions remains challenging. The development of conditional knockout models and tissue-specific approaches could help address this gap.

  • Signaling complexity: TAS2R46 likely activates multiple signaling pathways that may vary across cell types. Advanced proteomic and phosphoproteomic analyses could help delineate these complex signaling networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.