Recombinant Papio hamadryas Taste receptor type 2 member 8 (TAS2R8)

Shipped with Ice Packs
In Stock

Description

Functional Role of TASAS2R8

TAS2R8 is a bitter taste receptor involved in detecting toxic or harmful compounds. Key functional insights include:

  • Expression: Localized to taste receptor cells in the tongue and palate epithelia .

  • Ligand Specificity: Responds to bitter tastants, though exact ligands for TAS2R8 remain under investigation .

  • Evolutionary Context: TAS2R genes are clustered on chromosome 12p13 in humans, with orthologs in primates showing dietary adaptation-linked diversity .

Research Applications

Recombinant TAS2R8 is utilized in:

  • Ligand Screening: Identifying bitter compounds via in vitro assays .

  • Structural Studies: Mapping receptor-ligand interactions using mutagenesis .

  • Evolutionary Analysis: Comparative studies of TAS2R gene birth/death events in primates (e.g., colobines vs. cercopithecines) .

Key Research Findings

  • Dietary Adaptation: Folivorous colobine primates exhibit reduced intact TAS2R genes (20–28) compared to omnivorous cercopithecines (27–36), suggesting dietary-driven receptor diversification .

  • Functional Expression: Recombinant TAS2R8 enables high-throughput studies of bitter compound detection mechanisms .

Technical Considerations

  • Stability: Repeated freeze-thaw cycles degrade the protein; working aliquots stored at 4°C are stable for one week .

  • Purity: >85% as confirmed by SDS-PAGE .

  • Sequence Validation: Confirmed via mass spectrometry and N-terminal sequencing .

Implications for Future Studies

  • Ligand Identification: High-resolution crystallography of recombinant TAS2R8 could reveal binding pockets for bitter molecules.

  • Ecotoxicology: Assessing receptor responses to plant alkaloids in baboon habitats (e.g., Ethiopian highlands) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please specify your needs when placing the order, and we will prepare accordingly.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
TAS2R8; Taste receptor type 2 member 8; T2R8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MFSPADNIFIILITGEFIIGILGNGYIGLVNWIDWIKKKKISTIDCILTNLVISRICLIS VMVVNGIVIVLYPDVYTKTKLQIVICTFWTFANYLNMWFTACLNVFYSLKVANSSHPLFL WLKRKIDMVVRWILLGCFAISLLVSLIIATVLSHDYRFHAIAKHKRNVTEMFHVSKMPYF EPLTLFNLLAIVPFIVSLMSFFLLVRSLWRHTKQIKLYATGGRDPSTEAHVRAIKTMTLL IFFFFLYYITSLLVXFSYLITNYKLAMAFGEIVAILYPSGHSLILIILNNKLRQASVRML TCRKIACVT
Uniprot No.

Target Background

Function
This receptor potentially plays a role in bitter taste perception and is linked to gustducin. It may be involved in sensing the chemical composition of the gastrointestinal content. Activation of this receptor might stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R8 and what is its functional role?

TAS2R8 belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in clusters within the genome and are genetically linked to loci that influence bitter perception in both mice and humans. In functional expression studies, TAS2R8 responds to bitter tastants, indicating its primary role in bitter taste perception .

The gene for human TAS2R8 maps to the taste receptor gene cluster on chromosome 12p13.2. It has a single exon structure, which is characteristic of many taste receptor genes. The protein is part of a larger family of bitter taste receptors (TAS2Rs) that collectively enable humans to detect and respond to a wide range of bitter compounds .

How does the recombinant form of Papio hamadryas TAS2R8 differ from the human ortholog?

While human and Papio hamadryas TAS2R8 share considerable sequence homology, there are species-specific variations that may influence ligand binding and receptor activation. Comparative genomic studies of TAS2R family members have shown that certain receptor subtypes are conserved across species while others demonstrate species-specific adaptations .

When working with the recombinant form, researchers should note that the protein typically includes a tag for purification purposes, and the storage buffer often contains 50% glycerol optimized for protein stability. The recombinant protein is typically stored at -20°C, with extended storage recommended at -80°C to maintain functional integrity .

What experimental systems are commonly used to study TAS2R8 function?

TAS2R8 function is commonly studied using heterologous expression systems in which the receptor is expressed in cell lines such as HEK293T. These systems can be coupled with various detection methods to assess receptor activation:

  • Bioluminescence-based intracellular calcium release assays: These provide better performance than fluorescence-based assays, especially when screening agonists in autofluorescent matrices .

  • Fluorescence-based screening assays: While these have certain limitations compared to bioluminescence-based methods, they have been successfully used to identify TAS2R8 inhibitors .

  • Transient transfection of multigene plasmids encoding TAS2R8: This approach obviates the need for time-consuming stable cell line generation and allows for rapid high-throughput screening and characterization of ligand activity .

How can researchers optimize bioluminescence-based assays for TAS2R8 functional studies?

Bioluminescence-based assays for TAS2R8 offer several advantages over traditional fluorescence-based methods, particularly when dealing with autofluorescent samples that can negatively interfere with fluorescence signals. To optimize these assays, researchers should consider:

  • Enhancing functional expression of TAS2R8 at the plasma membrane by altering N-terminal signal sequences, which can significantly enlarge the assay window and improve performance .

  • When working with plant or food samples that contain autofluorescent compounds, the bioluminescence-based assay allows for more accurate detection of receptor activation without interference .

  • For high-throughput screening applications, transient transfection of heterologous cells with multigene plasmids encoding TAS2R8 provides a rapid alternative to stable cell line generation, though optimization of transfection conditions is crucial for consistent results .

The robustness and sensitivity of bioluminescence-based assays have revealed novel insights into TAS2R-ligand pharmacology that may not be detectable with less sensitive methods .

What are the challenges in comparative functional analysis of TAS2R8 across species?

Comparative functional analysis of TAS2R8 across species presents several challenges that researchers must address:

  • Phylogenetic variations: Studies of the TAS2R family have shown that of the 24 subtypes of human TAS2R, only 8 had orthologs in pig, mouse, and rat, while 13 had orthologs in rodents but not in pig. This phylogenetic diversity complicates direct functional comparisons .

  • Ligand specificity differences: Even between closely related species, TAS2R8 may exhibit different ligand binding profiles. For example, studies with TAS2R5 (another TAS2R family member) showed that it has unique functional specificity in humans with no direct ortholog in other species .

  • Receptor tuning variations: TAS2R receptors range from broadly tuned to narrowly tuned. Understanding these tuning differences requires comprehensive pharmacological profiling with diverse bitter compounds .

When comparing Papio hamadryas TAS2R8 with human TAS2R8, researchers should consider these potential functional differences and design experiments to specifically examine conservation or divergence of ligand specificity and response characteristics.

What approaches are most effective for structure-function studies of TAS2R8?

For structure-function studies of TAS2R8, researchers should consider the following methodological approaches:

  • Mutagenesis studies: Systematic mutation of key residues in transmembrane domains and loops can identify critical regions for ligand binding and receptor activation. Based on GPCR database information, mutations that cause >5-fold or >10-fold changes in binding/potency have been documented for TAS2R8 .

  • Chimeric receptor analysis: Creating chimeric receptors between TAS2R8 and other TAS2R family members can help identify domains responsible for specific ligand interactions. This is particularly valuable when comparing receptors with overlapping but distinct agonist profiles .

  • Computational modeling: Using the known sequence of TAS2R8 in conjunction with structural templates from other GPCRs, researchers can build homology models to predict ligand binding sites and functional motifs. These models can then be validated through experimental approaches .

  • Cross-species comparative analysis: While challenging due to phylogenetic variations, comparing the function of TAS2R8 across species can provide insights into evolutionary adaptations and conserved functional domains. For example, comparing agonists that are common to multiple TAS2R subtypes can reveal functional relationships even between phylogenetically distant receptors .

How does TAS2R8 research contribute to understanding bitter taste perception mechanisms?

Research on TAS2R8 provides critical insights into the molecular mechanisms of bitter taste perception:

  • Receptor-ligand specificity: TAS2R8 studies help define the molecular basis for the recognition of specific bitter compounds, contributing to our understanding of taste coding at the receptor level .

  • Signal transduction pathways: Investigations of TAS2R8 activation reveal details about the downstream signaling events that translate chemical detection into sensory perception .

  • Evolutionary adaptations: Comparative studies of TAS2R8 across species illuminate how bitter taste perception has evolved in response to different ecological niches and dietary exposures .

  • Genetic variations: Research on polymorphisms in TAS2R8 helps explain individual differences in bitter taste perception and sensitivity, which can influence food preferences and consumption patterns .

What is the current state of knowledge regarding TAS2R8 inhibitors and their mechanisms of action?

Recent advances in TAS2R8 research have led to the identification of synthetic inhibitors that function as potent bitter taste blockers. These findings have both fundamental and applied significance:

  • Molecular mechanisms: Studies have shown that TAS2R8 inhibitors can act through various mechanisms, including competitive antagonism, allosteric modulation, and interference with downstream signaling components .

  • Screening methodologies: The development of stable TAS2R8 cell lines for fluorescence-based screening assays, coupled with human sensory evaluation, has enabled the identification and optimization of TAS2R8 inhibitors .

  • Validation approaches: After initial screening, potential bitter taste blockers require validation in human test panels, highlighting the importance of translational research in this field .

  • Pharmacological profiling: The bioluminescence-based assay serves as a valuable tool for screening TAS2R inhibitors and characterizing their functional properties, including potency, efficacy, and selectivity across TAS2R subtypes .

What methodological approaches can address the challenge of TAS2R8 expression in heterologous systems?

Expressing functional TAS2R8 in heterologous systems presents several challenges that require specific methodological solutions:

  • Optimizing cell surface expression: Altering N-terminal signal sequences has been shown to improve the functional expression of some TAS2Rs at the plasma membrane. This approach could be applied to TAS2R8 to enhance its expression and function in heterologous systems .

  • Transient vs. stable expression: While stable cell lines provide consistency, transient transfection with multigene plasmids encoding TAS2R8 offers a rapid alternative for high-throughput screening. Researchers should weigh these options based on their specific experimental needs .

  • Co-expression with signaling components: Ensuring proper coupling of TAS2R8 to downstream signaling components is critical for functional studies. This may require co-expression of specific G proteins or other signaling molecules .

  • Detection system selection: The choice between bioluminescence-based and fluorescence-based detection systems should consider factors such as sensitivity requirements, potential for matrix interference, and the specific questions being addressed .

How should researchers interpret dose-response data for TAS2R8 ligands in different assay systems?

Interpreting dose-response data for TAS2R8 ligands requires careful consideration of several factors:

  • Assay system differences: Data from bioluminescence-based assays may differ from fluorescence-based assays due to differences in sensitivity, signal-to-noise ratio, and potential interference from autofluorescent compounds. Direct comparison requires normalization and validation across platforms .

  • EC50 determination: Half-maximal effective concentration (EC50) values for TAS2R ligands should be calculated using appropriate curve-fitting models, typically employing nonlinear regression with variable slope parameters .

  • Efficacy vs. potency: Distinguishing between changes in efficacy (maximum response) and potency (EC50) is critical when comparing ligands or receptor variants. Some mutations may affect one parameter without altering the other .

  • Species differences: When comparing data across species, researchers should consider that even closely related TAS2R orthologs may exhibit different pharmacological profiles. For example, human TAS2R5 and mouse mTas2r144, while functionally similar in terms of agonist activation, are phylogenetically distant .

What are the key considerations for experimental design when studying TAS2R8 function in complex matrices?

Studying TAS2R8 function in complex matrices such as food or plant extracts presents unique challenges that require careful experimental design:

  • Matrix interference management: Bioluminescence-based assays offer advantages over fluorescence-based methods when working with autofluorescent matrices that can interfere with detection signals .

  • Extraction and purification protocols: When preparing samples from complex matrices, standardized extraction procedures are essential to ensure reproducibility and minimize interference from matrix components .

  • Controls and validation: Including appropriate positive and negative controls is crucial, as is validation of results using complementary approaches such as human sensory evaluation .

  • Considering multiple receptor effects: Complex matrices likely contain compounds that activate or inhibit multiple TAS2R subtypes. Since a single TRC may express several TAS2Rs, the eventual functional response in a physiological context may differ from results obtained by studying TAS2R8 in isolation .

What emerging techniques show promise for advancing TAS2R8 research?

Several emerging techniques hold significant promise for advancing TAS2R8 research:

  • CRISPR-Cas9 genome editing: This technology enables precise modification of TAS2R8 in relevant cell types or model organisms, facilitating detailed structure-function studies and the creation of knockout models .

  • Single-cell transcriptomics: This approach can reveal the co-expression patterns of TAS2R8 with other taste receptors and signaling components in individual taste cells, providing insights into functional specialization .

  • Cryo-electron microscopy: As this technique advances for membrane proteins, it may eventually enable determination of TAS2R8 structure at atomic resolution, revolutionizing our understanding of ligand binding and activation mechanisms .

  • Advanced computational modeling: Integration of molecular dynamics simulations with experimental data can generate refined models of TAS2R8-ligand interactions, facilitating rational design of modulators .

How might comparative genomic approaches further elucidate TAS2R8 evolution and function?

Comparative genomic approaches offer powerful tools for understanding TAS2R8 evolution and function:

  • Expanded phylogenetic analysis: Including TAS2R8 sequences from a broader range of species, particularly non-human primates like Papio hamadryas, can reveal evolutionary patterns and adaptive changes .

  • Selection pressure analysis: Examining patterns of sequence conservation and divergence can identify regions under positive or negative selection, highlighting functionally important domains .

  • Correlation with ecological and dietary factors: Relating TAS2R8 sequence variations to species-specific dietary adaptations can provide insights into the ecological drivers of receptor evolution .

  • Integration with functional data: Combining genomic comparisons with cross-species functional assays can establish links between sequence variations and changes in ligand specificity or sensitivity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.