Recombinant Papio hamadryas Taste receptor type 2 member 9 (TAS2R9)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Papio hamadryas Taste Receptor Type 2 Member 9 (TAS2R9)

Recombinant Papio hamadryas Taste Receptor Type 2 Member 9 (TAS2R9) is a laboratory-engineered protein derived from the bitter taste receptor gene TAS2R9 of the Hamadryas baboon (Papio hamadryas). This receptor belongs to the G protein-coupled receptor (GPCR) superfamily and is involved in detecting bitter compounds, playing roles in dietary adaptation and toxin avoidance . Recombinant production enables large-scale study of its structural, functional, and therapeutic properties .

Gene and Protein Features

  • Gene: TAS2R9 (aliases: T2R9, TRB6) .

  • Protein: 85% purity (≥85% confirmed via SDS-PAGE) .

  • Host Systems: Expressed in E. coli, yeast, baculovirus, or mammalian cell systems .

Table 1: Key Recombinant TAS2R9 Products for Papio hamadryas

Product CodeHost SystemPurityApplication
CSB-CF714513ERJE. coli≥85%Functional assays, drug delivery
CSB-EP714513ERJ1Mammalian cells≥85%Structural studies

Cancer Research

TAS2R9 is a stromal target in pancreatic ductal adenocarcinoma (PDAC). Conjugated liposomes targeting TAS2R9 selectively deliver drugs like CXCR2 inhibitors to cancer-associated fibroblasts (CAFs), reducing tumor growth by inhibiting the CXCL-CXCR2 axis .

Key Findings:

  • Targeted Drug Delivery: TAS2R9-specific liposomes show high stromal colocalization in PDAC xenografts .

  • Efficacy: CXCR2 inhibitor delivery via TAS2R9-targeted liposomes suppresses cancer cell proliferation .

Role in Primate Adaptation

  • Gene Duplication: TAS2R9 underwent lineage-specific duplications in Cercopithecidae (Old World monkeys), including Papio hamadryas, correlating with dietary diversification .

  • Diet-Driven Evolution: Folivorous colobines exhibit reduced TAS2R genes (20–28 intact genes) compared to omnivorous cercopithecines like baboons (27–36 genes), reflecting dietary toxin tolerance strategies .

Table 2: TAS2R Gene Repertoire in Primates

SubfamilySpeciesIntact TAS2R GenesDietary Preference
CercopithecinaePapio hamadryas27–36Omnivorous
ColobinaeColobus polykomos20–26Folivorous

Research Gaps and Future Directions

  • Mechanistic Studies: Detailed ligand-receptor interaction models for Papio hamadryas TAS2R9 remain understudied.

  • Therapeutic Expansion: Broader applications in stromal targeting for cancers beyond PDAC are unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. To prioritize a specific tag, please inform us during your order.
Synonyms
TAS2R9; Taste receptor type 2 member 9; T2R9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Papio hamadryas (Hamadryas baboon)
Target Names
Target Protein Sequence
MPSTIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDVSLIDIILISLAISRICLLC VISLDGFFILLFPGTYDINVLESIMDAVWTFANNSSLWFTSCLSIFYLLKIANISHPFFF WLKLKINKVILAILLGSFLISLIISFPINGXWYHLFKVSHEENITWAFKVSTIPGAFKQL TLNLGAMVPFMLCLISFFLLLFSLVRHTKQIQLHATGLRDPSTEAHMRAIKAVIIFLLLL IVYYPVFLVMTSSTLIPQGKLVLMIGDIVTVIFPSSHSFILIMGNSKLREAFLKMLRFVK GFLRRRKPFGP
Uniprot No.

Target Background

Function

Gustducin-coupled receptor involved in the detection of bitter compounds within the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.