Recombinant Parabacteroides distasonis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; BDI_0117; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Target Names
mscL
Target Protein Sequence
MKKILQEFKQFAMRGNVVDMAVGIIIGGAFGKIVSSIVADLIMPAVGLLVGGVNFTDLKI TLKHAVMEGDKVISPAVSINYGNFIQVTLDFIIIAFAVFLLVKGVNALSKKKEEAPKAPV APPADIQLLTEIRDLLKNNK
Uniprot No.

Target Background

Function
This protein is a large-conductance mechanosensitive channel (MscL) that opens in response to membrane stretch. It is believed to play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the Large-Conductance Mechanosensitive Channel (MscL) in Parabacteroides distasonis?

The Large-Conductance Mechanosensitive Channel (MscL) in Parabacteroides distasonis functions as an emergency release valve that opens in response to stretch forces in the lipid bilayer. Based on homologous bacterial MscL proteins, it likely forms a homopentamer with each subunit containing two transmembrane regions . The channel gates via a bilayer mechanism triggered by hydrophobic mismatch and changes in membrane curvature and/or transbilayer pressure profile .

MscL proteins typically form the largest gated pore known, capable of passing molecules up to 30 Å in diameter, and undergo substantial conformational changes during gating . In P. distasonis, this channel would help prevent cell lysis during osmotic shock by releasing cytoplasmic solutes when the bacterium encounters decreases in the osmotic environment .

How do I express and purify recombinant P. distasonis MscL for structural studies?

For expression and purification of recombinant P. distasonis MscL, researchers should consider the following protocol based on successful approaches with other bacterial MscL proteins:

Expression system:

  • Use E. coli as the heterologous expression system with a pET vector containing a His-tag for purification

  • Optimize codon usage for E. coli if necessary

  • Induce expression using IPTG at reduced temperatures (16-20°C) to enhance proper folding

Purification protocol:

  • Lyse cells using French Press disruption in a suitable buffer containing protease inhibitors

  • Perform membrane isolation by centrifugation (8,500 × g, 30 min)

  • Solubilize membrane proteins using mild detergents (e.g., n-dodecyl-β-D-maltopyranoside)

  • Purify using nickel affinity chromatography

  • Consider size exclusion chromatography for further purification

  • Verify purity using SDS-PAGE (>90% purity is desirable)

Storage recommendations:

  • Store in buffer containing 6% Trehalose at pH 8.0

  • Aliquot and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

What are the suitable methods for verifying the functionality of recombinant P. distasonis MscL?

To verify the functionality of recombinant P. distasonis MscL, researchers should utilize complementary approaches:

Patch-clamp electrophysiology:

  • Incorporate purified protein into proteoliposomes or planar lipid bilayers

  • Apply negative pressure to membranes to induce channel opening

  • Record single-channel conductance (expected to be approximately 3.6 nS based on other bacterial MscL channels)

  • Verify characteristic rapid transitions between open and closed states

Osmotic downshock assay:

  • Express recombinant MscL in MscL-deficient E. coli strain

  • Subject bacteria to rapid osmotic downshock

  • Measure survival rate compared to control strains

  • Functional MscL should rescue the osmotic sensitivity phenotype

Fluorescence-based approaches:

  • Label the recombinant MscL with environment-sensitive fluorophores

  • Monitor conformational changes upon membrane tension changes

  • This can provide insights into the gating mechanism without requiring electrophysiology

What expression vectors and conditions are optimal for producing functional recombinant P. distasonis MscL?

Based on successful approaches with other bacterial MscL proteins, the following expression systems and conditions are recommended:

Vector selection:

  • pET series vectors (particularly pET28a) with T7 promoter for high-level expression

  • Consider using a C-terminal His-tag to avoid interference with the N-terminal region that may be important for channel function

  • Include a TEV protease cleavage site for tag removal if necessary for functional studies

Expression conditions:

  • BL21(DE3) E. coli strain is recommended for high expression levels

  • Grow culture to OD600 of 0.6-0.8 before induction

  • Induce with 0.1-0.5 mM IPTG

  • Express at lower temperatures (16-20°C) overnight to facilitate proper membrane protein folding

  • Supplement growth medium with 1% glucose to repress basal expression

Membrane extraction:

  • Use French Press for bacterial lysis

  • Isolate membrane fraction by ultracentrifugation

  • Solubilize using appropriate detergents (DDM, LDAO, or Triton X-100)

How might the strain variability in P. distasonis affect MscL structure and function?

P. distasonis exhibits significant strain-to-strain variability that could impact MscL structure and function. Researchers investigating this should consider:

Genomic comparison methodology:

  • Perform comparative genomics of MscL gene sequences across P. distasonis strains

  • Apply typing systems similar to the rfbA-Typing system developed for P. distasonis

  • Group MscL variants into distinct lineages based on sequence variations

Structural implications:
P. distasonis can be classified into four distinct lineages (rfbA-Types I-IV) based on gene variations . Different strains show substantial variability in membrane composition and surface structures, which could affect:

  • MscL integration into the membrane

  • Gating tension sensitivity

  • Channel conductance and selectivity

Functional characterization protocol:

  • Clone and express MscL from multiple P. distasonis strains (particularly from Type I, which includes most pathogenic strains, versus other types)

  • Perform comparative electrophysiology to assess functional differences

  • Correlate structural variations with differences in:

    • Tension sensitivity

    • Open probability

    • Conductance

    • Ion selectivity

Connection to pathogenicity:
There is evidence suggesting that strain-dependent variations in P. distasonis affect pathogenicity and probiotic potential . MscL variations might contribute to these differences by affecting osmotic stress responses and bacterial survival in different host environments.

What role might P. distasonis MscL play in the bacterium's stress response during gut colonization?

The MscL in P. distasonis likely plays a crucial role in adapting to osmotic fluctuations in the gut environment. Understanding this requires:

Experimental approach to study in vivo relevance:

  • Generate MscL knockout strains of P. distasonis using CRISPR-Cas9 systems

  • Compare colonization efficiency of wild-type vs. knockout strains in gnotobiotic mouse models

  • Subject colonized mice to osmotic challenges (e.g., high-salt diet, osmotic laxatives)

  • Analyze bacterial abundance, distribution, and transcriptional changes

Factors affecting MscL function during colonization:

  • pH fluctuations in different gut regions

  • Osmolarity changes due to dietary variations

  • Bile acid concentrations (particularly relevant as P. distasonis metabolizes bile acids)

  • Host antimicrobial peptides that may alter membrane properties

Potential significance:
P. distasonis produces secondary bile acids that mediate anti-inflammatory effects . The bacterium's ability to withstand osmotic stress via MscL may be critical for maintaining colonization and thus its beneficial effects on the host. Particularly, the anaerobically cultured P. distasonis lysate used in therapeutic applications would require proper MscL function for bacterial survival during culturing.

What methodological considerations are important when analyzing the electrophysiological properties of recombinant P. distasonis MscL?

Electrophysiological analysis of recombinant P. distasonis MscL requires careful consideration of:

Reconstitution techniques:

  • Select appropriate lipid composition based on P. distasonis native membrane properties

  • Consider using E. coli polar lipids with added cholesterol as starting point

  • Prepare proteoliposomes with protein-to-lipid ratios of 1:1000 to 1:5000

  • Dehydration/rehydration method or detergent removal techniques can be used

Patch-clamp methodology:

  • Use symmetrical recording solutions containing 200 mM KCl, 40 mM MgCl2, 10 mM HEPES

  • Apply negative pressure incrementally (0-200 mmHg) to determine activation threshold

  • Record at multiple voltages (-100 to +100 mV) to assess voltage dependence

  • Single-channel recordings are preferred over macroscopic currents for detailed kinetic analysis

Data analysis parameters:

  • Calculate open probability (Po) as function of membrane tension

  • Determine conductance (expected to be ~3 nS based on other bacterial MscL channels)

  • Analyze dwell times in open and closed states

  • Fit data to appropriate gating models (e.g., two-state or sequential multi-state models)

Controls to include:

  • Recordings of liposomes without protein

  • Comparison with well-characterized E. coli MscL

  • Pharmacological tests with known MscL modulators like gadolinium

How can researchers investigate potential interactions between P. distasonis MscL and the host immune system?

P. distasonis has complex interactions with the host immune system, exhibiting both pro-inflammatory and anti-inflammatory effects . To investigate MscL's potential role:

Experimental design:

  • Prepare recombinant MscL protein and MscL-containing membrane vesicles

  • Expose human peripheral blood mononuclear cells (PBMCs) to these preparations

  • Measure cytokine production (IL-1β, IL-6, TNF-α, IL-10, IL-1RA) using ELISA or cytometric bead array

  • Compare responses to whole P. distasonis lysates

Expected cytokine profiles based on P. distasonis studies:
P. distasonis induces strain-dependent immune responses, as shown in the table below:

CytokineResponse to P. distasonisMscL-specific hypothesis
IL-1βOverproduction (300-600% compared to controls) May contribute if MscL serves as PAMP
IL-6Variable increase based on strain Likely minimal contribution
TNF-αSignificant increase (>300% vs. E. coli LPS) May contribute if recognized by TLRs
IL-10 (anti-inflammatory)Increased production Unknown contribution
IL-1RA (anti-inflammatory)Modest increase (~200% vs. control) Unknown contribution

Technical considerations:

  • Include appropriate controls (purified LPS, whole bacteria, other membrane proteins)

  • Use both recombinant MscL and MscL-containing proteoliposomes

  • Consider using TLR knockout cell lines to determine potential receptors involved

  • Examine whether MscL contributes to the reported ability of P. distasonis to increase regulatory T cell frequencies

What approaches should be used to investigate the potential role of P. distasonis MscL in the context of inflammatory bowel diseases?

Given the emerging evidence of P. distasonis importance in inflammatory bowel diseases (IBD), investigating MscL's role requires multiple approaches:

In vitro models:

  • Transfect intestinal epithelial cell lines (Caco-2, HT-29) with vectors expressing P. distasonis MscL

  • Assess barrier function changes using transepithelial electrical resistance (TEER) measurements

  • Determine if MscL affects tight junction protein expression (Occludin, ZO-1)

  • Compare wild-type vs. MscL-knockout P. distasonis effects on epithelial cells

Animal model studies:

  • Colonize germ-free mice with wild-type or MscL-knockout P. distasonis

  • Induce colitis using dextran sodium sulfate (DSS) or 2,4,6-trinitrobenzenesulfonic acid (TNBS)

  • Assess disease severity (weight loss, colon shortening, histology)

  • Analyze local and systemic immune responses

  • Compare findings with P. distasonis lysate treatments that have shown efficacy

Clinical sample analysis:

  • Analyze P. distasonis MscL expression in biopsy samples from IBD patients vs. healthy controls

  • Correlate MscL sequence variations with disease parameters

  • Investigate associations between MscL variations and P. distasonis abundance in ulcerative colitis patients based on time since relapse

The contradictory findings regarding P. distasonis in IBD (some studies show protective effects, while others associate it with relapse ) could potentially be explained by strain-dependent MscL variations affecting bacterial stress responses and host interactions.

What techniques can be used to study the gating kinetics and mechanosensitive properties of P. distasonis MscL?

To comprehensively characterize the gating kinetics and mechanosensitive properties of P. distasonis MscL, researchers should employ multiple complementary techniques:

High-speed atomic force microscopy (HS-AFM):

  • Reconstitute purified MscL into supported lipid bilayers

  • Apply controlled mechanical force while imaging

  • Track conformational changes in real-time

  • Analyze the sequence of structural transitions during gating

Single-molecule FRET spectroscopy:

  • Introduce cysteine pairs at strategic positions for fluorophore labeling

  • Label with donor-acceptor fluorophore pairs

  • Reconstitute labeled channels into liposomes

  • Apply membrane tension using osmotic gradients or micropipette aspiration

  • Monitor FRET efficiency changes during gating events

  • Calculate distance changes between labeled residues during channel opening/closing

Molecular dynamics (MD) simulations:

  • Build homology model of P. distasonis MscL based on available bacterial MscL structures

  • Embed model in lipid bilayer matching P. distasonis membrane composition

  • Apply lateral tension to membrane in silico

  • Simulate channel opening process

  • Calculate energy landscape and identify key residues involved in mechanosensation

Electrophysiology with modified lipid compositions:

  • Reconstitute MscL into liposomes with varying lipid compositions:

    • Different acyl chain lengths

    • Various degrees of saturation

    • Inclusion of bacterial-specific lipids

  • Determine how lipid environment affects:

    • Activation threshold

    • Open probability

    • Conductance

    • Open/closed dwell times

This multi-technique approach would provide comprehensive insights into the unique mechanosensitive properties of P. distasonis MscL compared to better-characterized bacterial MscL channels.

How might recombinant P. distasonis MscL be utilized in drug development research?

Recombinant P. distasonis MscL presents several promising applications in drug development research:

Antimicrobial development:
MscL has been identified as a potential antibiotic target and drug delivery route . For P. distasonis specifically:

  • Develop high-throughput screening assays using fluorescently labeled liposomes containing recombinant MscL

  • Screen for compounds that inappropriately trigger channel opening

  • Identify molecules that could selectively target P. distasonis in dysbiotic conditions

  • Test whether streptomycin utilizes P. distasonis MscL as an entry path as shown in other bacterial species

Targeted delivery systems:
P. distasonis has emerged as both potentially pathogenic and probiotic depending on context . Engineered MscL could be used to:

  • Create modified P. distasonis strains with engineered MscL variants responsive to specific triggers

  • Develop delivery systems that selectively target P. distasonis in the gut

  • Design triggered nanovalves based on MscL for controlled release applications

Relevance to inflammatory diseases:
Given P. distasonis' roles in conditions like inflammatory bowel disease, multiple sclerosis, and rheumatoid arthritis , MscL-targeting could potentially:

  • Selectively modulate P. distasonis abundance in specific disease contexts

  • Alter the bacterium's stress responses and colonization abilities

  • Potentially convert pathogenic strains to beneficial ones through modulation of their stress response systems

What is the significance of studying P. distasonis MscL in the context of the bacterium's dual roles in health and disease?

P. distasonis exhibits a complex dual nature - it can be both pathogenic and beneficial depending on context. Studying its MscL is significant because:

Strain differentiation insights:
P. distasonis strains show significant variability in their effects:

  • Some strains have probiotic-like anti-inflammatory properties

  • Others are associated with IBD relapse , depressive-like behavior , and other pathologies

  • MscL characteristics might serve as markers to differentiate beneficial from harmful strains

Therapeutic development opportunities:

  • P. distasonis lysate has shown promise in preventing severe forms of experimental autoimmune encephalomyelitis (EAE)

  • Understanding how MscL contributes to bacterial survival during lysate preparation could improve therapeutic efficacy

  • Targeting MscL could potentially enhance beneficial effects or reduce pathogenic potential

Environmental adaptation mechanism:

  • MscL helps bacteria survive osmotic fluctuations in the gut environment

  • This adaptation mechanism might influence:

    • Colonization efficiency in different gut regions

    • Competitive advantage during microbiome perturbations

    • Stress responses that alter metabolite production

Comparative data from studies:

P. distasonis functionContextPotential MscL relevance
Anti-inflammatoryPrevents severe EAE Survival during inflammation
Pro-inflammatoryAssociated with UC relapse Strain-specific variations
ImmunomodulatoryAlters T cell balance Possible PAMP function
MetabolicProduces beneficial bile acids Survival during bile exposure
PathogenicContributes to depression in mice Adaptation to brain-gut axis

Understanding MscL's role in these diverse contexts could help explain the bacterium's dual nature and inform targeted therapeutic approaches.

How does the study of P. distasonis MscL contribute to our broader understanding of bacterial mechanosensation?

The study of P. distasonis MscL contributes valuable insights to our understanding of bacterial mechanosensation in several ways:

Evolutionary perspectives:

  • P. distasonis belongs to Bacteroidetes phylum, while most studied MscL channels are from Proteobacteria or Firmicutes

  • Comparative analysis of MscL across these diverse phyla can reveal:

    • Conserved mechanosensing mechanisms

    • Phylum-specific adaptations

    • Evolutionary pressure on mechanosensitive channels in different niches

Structural-functional relationships:

  • P. distasonis MscL likely contains the conserved N-h-h-D motif seen across channel families

  • Studying how this motif functions in the context of P. distasonis' unique membrane composition provides insights into:

    • Essential vs. adaptable structural elements

    • Environment-specific modifications of channel function

    • Lipid-protein interactions that modulate sensitivity

Specialized adaptations:
P. distasonis possesses unique membrane characteristics including:

  • An S-layer not present in many other bacteria

  • Ability to coat its surface with host-derived sugar residues

  • Production of specific antimicrobial peptides

These features likely create a unique membrane environment for MscL function, potentially revealing new principles of mechanosensation in specialized bacterial membranes.

Methodological advancements:
Techniques developed to study P. distasonis MscL can advance the broader field:

  • Methods for expression and purification of challenging membrane proteins

  • Approaches to study mechanosensitive channels in diverse lipid environments

  • Integration of genetic, structural, and functional analyses of bacterial channels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.