Recombinant Parabacteroides distasonis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Parabacteroides distasonis Membrane Protein Insertase YidC (yidC) is a bacterial membrane protein engineered for research and therapeutic applications. It belongs to the YidC family of insertases, which are evolutionarily conserved across Gram-negative bacteria, archaea, and eukaryotic organelles . YidC facilitates the insertion of nascent membrane proteins into lipid bilayers, either independently or in collaboration with the Sec translocase complex . In P. distasonis, this protein is expressed as a recombinant form, typically in Escherichia coli, for structural and functional studies .

Functional Mechanisms

YidC operates through two primary pathways:

  1. Sec-dependent pathway: Couples with the SecYEG translocon to release hydrophobic segments into the membrane .

  2. Sec-independent pathway: Directly inserts single- or double-spanning proteins (e.g., Pf3 coat protein) via its groove-like structure .

Key Functional Insights

  • Chaperoning role: Accelerates folding of polytopic proteins like MelB by stabilizing intermediate states .

  • Substrate specificity: Recognizes hydrophobic regions but lacks sequence specificity, enabling broad applicability .

Production and Expression Systems

Recombinant YidC is typically produced via heterologous expression:

ParameterDetailSource
Host organismE. coli
PurificationNickel affinity chromatography (His-tag)
StabilityLyophilized powder stored at -20°C/-80°C
Activity validationReconstituted into proteoliposomes for in vitro insertion assays

Membrane Protein Biogenesis Studies

  • Pf3 coat protein insertion: YidC alone enables efficient insertion of single-spanning proteins into liposomes .

  • Melibiose permease (MelB): YidC chaperones folding of pseudo-symmetric α-helical bundles, preventing misfolding .

Antibacterial Targeting

  • Essential gene: Depletion via antisense RNA impairs growth, sensitizing E. coli to eugenol and carvacrol .

  • Synergy potential: Fractional inhibitory concentration indices (FICIs) suggest eugenol + YidC depletion = high synergy .

Antibacterial Development

  • Targeted inhibition: YidC’s divergence from eukaryotic homologs (e.g., Oxa1p) makes it a viable broad-spectrum target .

  • RNA silencing: Antisense RNA reduces YidC expression, sensitizing bacteria to essential oils .

Biotechnological Tools

  • Protein engineering: Recombinant YidC aids in studying membrane protein folding and insertion dynamics .

  • Probiotic applications: P. distasonis lysates (containing YidC) modulate immune responses, though YidC’s role remains indirect .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; BDI_0520; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-633
Protein Length
full length protein
Species
Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Target Names
yidC
Target Protein Sequence
MDKNTLIGFLLIGVVLFAFSWFNRPTPEQLEAQRRYQDSIAKIEYAQQLELQKQENKSAL VEDSLENLPDSVRAQRLQQSFGVFGDAMVGTEDYTTLQNDVVELRISNKGGRICYARLKE YDTYNDEPLVLFDEKESNFNFTLVTATNRVVNTSDLYFTPVKGNDPNSVIMRLNTGEGSH LDFTYTLKPDDYMVQYQILGTGLNGVLAPSTNALDLLWEQDIRQQEKGRKFEDRYVTLNY KFMADDVEHLSESKSDSKQIPNRLKWIGYKDMFFSTVLISQEGFEATTLDSKAIPEGDVL KQFKTTASVPFDLQGKEATNLSFYFGPNKFALLKSFDKGVSAEQQLDLEKLVPLGWGIFR WVNQYFVIPLFDFLGKFIHNYGILILLMTIIVKIILFPLTYKSYMSSAKMRVLRPQVEEI NAKYPGQDKAMERQKATMELYSRAGASPMSGCLPMLLQMPILIALFMFFPSAIELRHQSF LWAHDLSTYDAIFSWNKYIPIITPYFGNHISLFCLLMTITNIFYTKYNMEMTNTGQQQMP GMKAMMYMMPLMFLVFFNQYASGLTYYYFISTLITIVQTLIFRYTINEDKLLAKLEANKR KPMKKSGFMKRLEEAQRAQQETLRKQQEAKKKR
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It participates in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, and some lipoproteins. It further assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of Parabacteroides distasonis YidC?

Parabacteroides distasonis YidC is a membrane protein insertase consisting of 633 amino acids. Like other YidC family proteins, it contains multiple transmembrane helices that thread back and forth through the bacterial membrane. While specific P. distasonis YidC structures haven't been fully characterized, models based on evolutionary analysis of related YidC proteins suggest it likely contains five transmembrane domains with a hydrophilic groove that facilitates membrane protein insertion . The protein contains both hydrophobic exterior residues that stabilize interactions with lipid tails and interior polar/charged residues on the cytoplasmic side that engage in electrostatic interactions .

How does P. distasonis YidC function in membrane protein insertion?

P. distasonis YidC functions by creating a hydrophilic groove that is open to the cytosol and penetrates partially into the membrane, facilitating the insertion of membrane proteins . This groove exposes hydrophilic groups to the hydrophobic membrane, creating membrane distortion and thinning in its vicinity . Unlike SecY, which forms a continuous hydrophilic pore across the membrane, YidC's hydrophilic groove only penetrates part-way, functioning as a "half-channel" . This structure enables YidC to assist in the lateral movement of transmembrane segments into the lipid bilayer while shielding hydrophilic regions during the insertion process .

What expression systems are recommended for recombinant P. distasonis YidC production?

For recombinant expression of P. distasonis YidC, E. coli has been successfully used as an expression host. The full-length protein (amino acids 1-633) can be expressed with an N-terminal His-tag to facilitate purification . The recombinant protein is typically expressed in E. coli and purified to greater than 90% homogeneity as determined by SDS-PAGE . When designing expression constructs, it's important to consider that membrane proteins like YidC can be challenging to express, and optimization of expression conditions (temperature, inducer concentration, and duration) may be necessary to maximize yield while maintaining proper folding.

What are the recommended storage conditions for recombinant P. distasonis YidC?

Recombinant P. distasonis YidC is typically stored as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default) and store in aliquots at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to maintain protein stability. For short-term use, working aliquots may be stored at 4°C for up to one week . The protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

How can researchers investigate interactions between P. distasonis YidC and substrate proteins?

To investigate interactions between P. distasonis YidC and its substrate proteins, researchers can employ multiple complementary approaches:

  • Proximity-dependent biotin labeling (BioID): This technique has been successfully used to identify interaction partners of YidC, as demonstrated in the identification of YibN as a crucial component within the YidC protein environment .

  • Affinity purification-mass spectrometry: This approach can be conducted on native membranes to confirm interactions identified through other methods. This technique provides a comprehensive identification of proteins that physically associate with YidC in a near-native environment .

  • On-gel binding assays: Using purified proteins, researchers can perform on-gel binding assays to verify direct interactions between YidC and potential substrates or partners .

  • Co-expression studies: By co-expressing YidC with potential substrate proteins (such as phage coat proteins or ATP synthase subunits), researchers can assess the functional impact of YidC on substrate insertion and folding .

  • In vitro reconstitution assays: Purified YidC can be reconstituted into proteoliposomes along with radiolabeled or fluorescently tagged substrate proteins to directly monitor insertion efficiency under controlled conditions.

What methodological approaches are effective for analyzing YidC-mediated membrane protein insertion?

Effective methodological approaches for analyzing YidC-mediated membrane protein insertion include:

  • In vitro translation-insertion assays: This approach involves translating substrate proteins in the presence of YidC-containing membranes or proteoliposomes, followed by analyzing membrane integration through protease protection assays or floatation in sucrose gradients.

  • Molecular dynamics simulations: MD simulations have proven valuable for characterizing the stability and biochemical properties of YidC in bacterial membranes. Simulations using models with appropriate lipid composition (e.g., 3 POPE to 1 POPG for bacterial membranes) can provide insights into membrane thinning, interaction energies, and hydrogen bonding patterns associated with YidC-mediated insertion .

  • Site-directed mutagenesis coupled with functional assays: By creating alanine mutants of specific YidC residues and subjecting them to in vivo complementation assays, researchers can identify functionally critical residues. For example, studies on E. coli YidC have shown that mutations in residues such as T362 in TM2 and Y517 in TM6 completely inactivate the protein despite stable expression .

  • In vivo insertion assays using reporter fusion proteins: These assays utilize fusion proteins between YidC substrates and reporters such as alkaline phosphatase or green fluorescent protein to monitor insertion efficiency in vivo.

How can researchers distinguish between Sec-dependent and YidC-only insertion pathways?

Distinguishing between Sec-dependent and YidC-only insertion pathways requires carefully designed experiments:

  • Depletion studies: Researchers can use strains with conditional expression of SecY or YidC to deplete one component while maintaining the other, then assess the insertion of various substrates to determine pathway dependence.

  • Reconstituted systems: In vitro reconstitution with purified components allows precise control over the presence or absence of Sec machinery and YidC, enabling direct assessment of insertion requirements.

  • Substrate engineering: By modifying key features of substrate proteins, such as charge distribution, hydrophobicity, or topology, researchers can analyze how these features determine the insertion pathway.

  • Crosslinking approaches: These can identify physical interactions between nascent membrane proteins and either SecY or YidC during the insertion process, providing direct evidence for pathway utilization.

  • Co-expression analysis: Co-expressing YidC with proteins like YibN has been shown to enhance the production and membrane insertion of specific YidC substrates, including M13 and Pf3 phage coat proteins, ATP synthase subunit c, and small membrane proteins like SecG . This approach can help identify substrates that preferentially use the YidC pathway.

What evolutionary insights can be gained from studying P. distasonis YidC?

Studying P. distasonis YidC can provide several evolutionary insights:

  • Ancestral protein channel identification: Research suggests that YidC may be the oldest known protein channel, serving as the evolutionary progenitor of SecY . This positions YidC as a key protein for understanding the evolution of membrane protein insertion mechanisms.

  • Conserved structural elements: The hairpin-interrupted three-transmembrane helix motif of YidC shows striking similarity to consensus proto-SecY elements, with each consensus helix from the YidC family matching to a consensus helix from proto-SecY with the same connectivity .

  • Functional transitions in evolution: YidC can be viewed as a "half-channel" capable of forming a near-complete channel through antiparallel homodimerization, potentially representing an evolutionary intermediate between simpler membrane proteins and more complex translocons .

  • Microbial adaptations: By comparing YidC from P. distasonis with homologs from other bacterial species, researchers can gain insights into how different microbes have adapted this essential machinery for their specific membrane environments and protein insertion needs.

What are the critical parameters for successful molecular dynamics simulations of P. distasonis YidC?

Successful molecular dynamics simulations of P. distasonis YidC require careful attention to several parameters:

  • Force field selection: The CHARMM36 force field has been successfully used for proteins and lipids in YidC simulations . This force field, combined with the TIP3P water model, provides accurate representation of membrane protein dynamics.

  • Membrane composition: A lipid composition of 3 POPE to 1 POPG has been successfully used for modeling bacterial membranes in YidC simulations . This ratio accurately represents the negative charge and fatty acid composition of bacterial membranes.

  • Simulation box dimensions: For a typical YidC simulation, an initial membrane surface area of approximately 110 Å × 110 Å is recommended, with 25 Å thick layers of water along the Cartesian Z directions .

  • System neutralization: The system should be neutralized using Monte Carlo sampling of Na+ ions or other appropriate counterions .

  • Equilibration protocol: A multi-stage equilibration is recommended, beginning with restraints on the protein and gradually releasing them over several nanoseconds before production runs.

  • Production run duration: Production runs of at least 100 ns are recommended for analyzing stable interactions, with longer simulations (500+ ns) providing more robust sampling of conformational dynamics.

  • Analysis methods: Important analyses include interaction energy calculations, hydrogen bond analysis, membrane thinning quantification, and positional variance of helix residues as a measure of flexibility .

What strategies can overcome challenges in expressing and purifying functional recombinant P. distasonis YidC?

Expressing and purifying functional membrane proteins like P. distasonis YidC presents several challenges. The following strategies can help overcome these issues:

  • Expression optimization:

    • Test multiple expression strains, including those specifically designed for membrane proteins (C41, C43, Lemo21)

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider using fusion tags that enhance membrane protein expression (Mistic, SUMO)

    • Evaluate co-expression with chaperones or YidC-interacting proteins like YibN

  • Solubilization optimization:

    • Test a panel of detergents with varying properties (DDM, LMNG, LDAO)

    • Optimize detergent concentration and solubilization time

    • Consider native nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) for detergent-free extraction

  • Purification strategies:

    • Implement two-step purification using the His-tag followed by size exclusion chromatography

    • Monitor protein quality using dynamic light scattering or fluorescence-detection size exclusion chromatography

    • Consider on-column detergent exchange during affinity purification

  • Functional verification:

    • Develop activity assays to verify that the purified protein maintains insertase activity

    • Use circular dichroism or infrared spectroscopy to confirm proper secondary structure

    • Reconstitute into proteoliposomes and test function with model substrates

What controls should be included when investigating P. distasonis YidC interactions with potential substrates?

When investigating interactions between P. distasonis YidC and potential substrates, the following controls are essential:

  • Negative controls:

    • Non-substrate membrane proteins that are known to use Sec-dependent pathways

    • Soluble proteins that should not interact with YidC

    • Mutated YidC versions with disrupted hydrophilic grooves or substrate binding sites

  • Positive controls:

    • Well-established YidC substrates such as M13 and Pf3 phage coat proteins or ATP synthase subunit c

    • Small membrane proteins like SecG that have been shown to interact with YidC

  • Specificity controls:

    • Competition assays with unlabeled substrate

    • Dose-response analyses to establish binding kinetics

    • Crosslinking with non-specific crosslinkers versus site-specific crosslinkers

  • System validation controls:

    • Verification of YidC activity using established functional assays

    • Confirmation of proper membrane integration using protease protection assays

    • Validation of protein-protein interaction techniques using known interaction partners

How should researchers interpret changes in membrane properties when studying YidC function?

When studying YidC function, researchers should consider several aspects when interpreting changes in membrane properties:

  • Membrane thinning: YidC's hydrophilic groove exposure to the hydrophobic membrane distorts and thins the membrane in its vicinity . This thinning can be quantified in simulations by measuring the minimum distance between phosphate groups on opposite leaflets . When interpreting experimental results, localized membrane thinning around YidC may indicate functional insertion sites.

  • Lipid organization changes: Overproduction of YidC-interacting proteins like YibN has been found to stimulate membrane lipid production and promote inner membrane proliferation, possibly by interfering with YidC lipid scramblase activity . When analyzing lipid composition data, researchers should consider both direct effects of YidC and indirect effects through its interaction partners.

  • Hydrophobicity profiles: Analysis of YidC's interaction with the membrane reveals that hydrophobic residues on the exterior of the transmembrane bundle stabilize interactions with apolar lipid tails, while the interior contains polar or charged residues on the cytoplasmic side and aromatic residues on the periplasmic side . Changes in these interaction patterns may signify functional alterations.

  • Protein flexibility: Positional variance analysis of helix residues provides a measure of flexibility that can indicate functional states of YidC . Regions with high flexibility may represent dynamic functional domains involved in substrate recognition or membrane insertion.

What methods are most appropriate for analyzing evolutionary relationships between YidC and other membrane protein insertases?

For analyzing evolutionary relationships between YidC and other membrane protein insertases, the following methods are most appropriate:

  • Multiple sequence alignment with specialized algorithms: Programs optimized for membrane proteins that can account for the constraints of transmembrane regions should be used to align YidC sequences across diverse organisms.

  • Covariation analysis: This approach has been successfully used to predict contacts between residue pairs based on evolutionary coupling, revealing structural relationships between YidC and SecY . Specifically, the analysis of diagonal and anti-diagonal patterns of coupling coefficients can indicate parallel or anti-parallel helix-helix pairs .

  • Structural comparison: The comparison of three-dimensional structures, particularly the arrangement of transmembrane helices, can reveal evolutionary relationships not evident from sequence analysis alone. The hairpin-interrupted three-TMH motif of YidC shows striking similarity to consensus proto-SecY elements, suggesting an evolutionary relationship .

  • Functional domain mapping: Identifying conserved functional domains across different insertases can provide insights into evolutionary relationships based on shared mechanisms rather than just sequence similarity.

  • Phylogenetic analysis with appropriate models: When constructing phylogenetic trees, models that account for the unique evolutionary constraints on membrane proteins should be employed, such as models that incorporate hydrophobicity profiles and transmembrane topology predictions.

How can researchers quantitatively assess the impact of YidC and its interactors on membrane protein insertion efficiency?

Researchers can quantitatively assess the impact of YidC and its interactors on membrane protein insertion efficiency through several approaches:

  • In vitro translation-insertion assays: These assays can provide quantitative measurements of insertion efficiency by calculating the percentage of synthesized protein that becomes properly integrated into the membrane. The effect of factors like YibN can be measured by comparing insertion efficiency with and without the interactor .

  • Protease protection assays: These assays allow researchers to quantify the proportion of a protein that is properly inserted into the membrane (protected from protease digestion) versus portions that remain exposed. Results can be quantified via densitometry of protected fragments.

  • Fluorescence-based reporter systems: By fusing fluorescent proteins to YidC substrates, researchers can quantitatively measure insertion efficiency based on fluorescence localization or protease accessibility of the reporter.

  • Mass spectrometry-based quantification: Stable isotope labeling approaches can provide precise quantification of changes in membrane proteome composition when YidC or its interactors are modulated.

  • Growth complementation assays: In systems where YidC is essential, complementation efficiency by mutant variants can be quantitatively assessed through growth rate measurements, providing an indirect measure of insertion activity.

  • Co-expression analysis with quantification: When co-expressing YidC with interactors like YibN, quantitative assessments can be made of how these interactions affect the production and membrane insertion of specific YidC substrates such as phage coat proteins and ATP synthase subunit c .

What are the promising approaches for studying the dual role of YidC as both an insertase and lipid scramblase?

The dual role of YidC as both an insertase and lipid scramblase presents unique research opportunities. Promising approaches include:

  • Lipid scrambling assays: Developing fluorescent lipid analogs or spin-labeled lipids that can be tracked as they move between membrane leaflets in the presence of YidC.

  • Structure-function analysis: Creating YidC variants with mutations in regions predicted to be involved in either protein insertion or lipid scrambling to dissect these potentially separable functions.

  • Real-time monitoring systems: Implementing systems that can simultaneously track both protein insertion and lipid movement to determine whether these activities are coupled or independent.

  • Interactor studies: Further investigation of proteins like YibN, which may modulate YidC's dual functions, potentially by interfering with its lipid scramblase activity while enhancing insertion activity .

  • Comparative analysis across species: Comparing YidC homologs from diverse bacterial species to identify conserved versus species-specific features related to insertase and scramblase functions.

  • Integration with membrane biophysics: Combining functional assays with detailed biophysical measurements of membrane properties to understand how YidC's activities affect and are affected by membrane physical states.

  • Cryo-EM studies: Obtaining high-resolution structures of YidC in different functional states, particularly in complex with substrates or lipids, to visualize the molecular basis of its dual function.

How might targeting P. distasonis YidC inform therapeutic strategies against gut microbiome dysbiosis?

Targeting P. distasonis YidC could potentially inform therapeutic strategies against gut microbiome dysbiosis in several ways:

  • Selective modulation: As an essential protein for membrane biogenesis, YidC represents a potential target for selectively modulating P. distasonis abundance in the gut microbiome, which could be beneficial in conditions where this bacterium is implicated in dysbiosis.

  • Substrate delivery systems: Understanding how YidC inserts proteins into the bacterial membrane could inform the design of delivery systems that target specific bacterial populations in the gut.

  • Membrane permeability manipulation: Insights into YidC's role in membrane organization could reveal approaches to selectively alter membrane permeability of specific bacterial species, potentially enhancing antibiotic efficacy.

  • Prebiotic development: Knowledge of YidC's function could inform the development of prebiotics that selectively promote or inhibit P. distasonis growth through effects on membrane protein insertion processes.

  • Diagnostic markers: Understanding YidC function and regulation could identify potential diagnostic markers for assessing P. distasonis membrane dynamics in different disease states.

  • Cross-talk with host: Research into how P. distasonis YidC-mediated membrane composition affects interactions with host cells could reveal new mechanisms underlying host-microbe relationships in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.