Recombinant Parabacteroides distasonis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain stability for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
uppP; BDI_2407; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Target Names
uppP
Target Protein Sequence
MSWFEALILGIVQGLTEYLPVSSSGHLAIGSALFGIEGEENLAFTIVVHVATVFSTLVVL WKEIDWIFRGLFKFQMNAETKYVINILISMIPIGIVGVFFKDTVEQIFGSGLLVVGCMLL LTAALLAFSYYAKPRQKESISMKDAFIIGLAQACAVMPGLSRSGSTIATGLLLGNNKAKL AQFSFLMVIPPILGEALLDVMKMVKGEDVAGDIPALSLAVGFMAAFVSGCVACKWMINIV KKGKLIYFAIYCAIAGLVTIACTLLK
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Parabacteroides distasonis and what is its significance in human health?

Parabacteroides distasonis is a Gram-negative, rod-shaped, obligatory anaerobic bacterium that was first isolated from human feces in 1933. It serves as the reference type strain for the genus Parabacteroides and is a commensal bacterium in the gastrointestinal tract of humans and animals . P. distasonis has demonstrated ambivalent roles, exhibiting both pathogenic and probiotic properties. Recent research indicates it plays protective roles against multiple sclerosis, diabetes, cancer, and Crohn's disease, while also potentially contributing to antimicrobial resistance and other clinical developments .

A single P. distasonis ATCC 8503 cell measures 0.8–1.6 × 1.2–12 μm in size. When cultured on sheep blood agar plates, it forms colonies that are 1–2 mm in diameter, appearing gray to off-white with circular, slightly convex, and smooth morphology .

What is the function of Undecaprenyl-diphosphatase (uppP) in bacterial systems?

Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase, is an integral membrane protein involved in bacterial cell wall synthesis . It catalyzes the critical dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as an essential carrier lipid in the bacterial cell wall synthesis pathway . This enzymatic activity is fundamental to bacterial cell wall integrity and function.

How is P. distasonis taxonomically distinguished from related bacterial species?

P. distasonis exhibits distinct chemo-taxonomic features that differentiate it from related species. The ratios of anteiso-C15:0 to iso-C15:0 range from 3.1 to 10.3 in P. distasonis strains, while those for T. forsythensis range from 22.8 to 95.2. Major menaquinones of P. distasonis are MK-9 and MK-10, while Bacteroides species typically contain MK-10 and MK-11 . These biochemical differences were significant enough to prompt researchers to place P. distasonis in its own genus, named Parabacteroides, meaning "adjacent to Bacteroides."

What is known about the active site and structure of Undecaprenyl-diphosphatase?

Computational modeling, molecular dynamics, and mutagenesis studies have proposed that the enzyme active site is composed of two key consensus motifs: (E/Q)XXXE and PGXSRSXXT, along with a histidine residue. This active site is proposed to be located in the periplasm . Sequence alignment has revealed two consensus regions containing glutamate-rich motifs that are critical for enzyme function. Understanding this structure provides insights into the enzyme's catalytic mechanism and potential for inhibitor development.

How does P. distasonis uppP catalyze the dephosphorylation reaction?

The enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate to form undecaprenyl phosphate. While the exact catalytic mechanism isn't fully detailed in the available research, the identified active site motifs (E/Q)XXXE and PGXSRSXXT along with a histidine residue likely coordinate the binding of the substrate and facilitate the phosphate hydrolysis . This enzymatic activity is essential for bacterial cell wall biosynthesis and represents a potential antibiotic target.

What biochemical assays can be used to measure uppP activity?

Researchers can measure uppP activity through several approaches, although specific methods aren't detailed in the search results. Typical assays for phosphatase activity include:

  • Colorimetric detection of released phosphate using molybdate-based reagents

  • Radiometric assays using labeled substrates

  • HPLC-based detection of reaction products

  • Coupled enzyme assays that link phosphate release to detectable signals

These assays would need to be adapted to the membrane-associated nature of the enzyme and its specific substrate requirements.

What methods are used to isolate and culture P. distasonis?

P. distasonis requires strict anaerobic conditions for cultivation. Based on the literature, researchers typically culture this organism under conditions of 80% H₂, 10% CO₂, 10% N₂ at 35°C for 4 days . Small colonies (1–2 mm) are selected and subcultured under anaerobic conditions at 35°C for 2 days. The bacterium can be definitively identified using matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) Biotyper .

How is the genome of P. distasonis analyzed and what are its key features?

The genome of P. distasonis strain GP102 has been completely sequenced and analyzed. Sequencing involved both Illumina short reads (n = 1,487,056) and Nanopore long reads (n = 35,990; N₅₀ = 3,369 bp), which were assembled into one circular contig with 193× depth using Unicycler . The genome consists of one circular chromosome that is 5,387,833 bp in length with a G+C content of 44.79%. When annotated using the NCBI Prokaryotic Genome Annotation Pipeline (PGAP v4.11), the genome was found to contain 4,730 coding genes, 122 pseudo genes, 84 tRNAs, 21 rRNAs, and 1 CRISPR array .

What are the optimal production methods for recombinant P. distasonis uppP?

Recombinant P. distasonis uppP can be produced using a baculovirus expression system. This approach has yielded protein with >85% purity as determined by SDS-PAGE . The recombinant protein is derived from P. distasonis strain ATCC 8503, which is also cataloged as DSM 20701, CIP 104284, JCM 5825, and NCTC 11152 . This standardized production system allows for consistent protein quality for research applications.

Table 1: Production and Storage Parameters for Recombinant P. distasonis uppP

ParameterSpecification
Expression SystemBaculovirus
Source StrainP. distasonis ATCC 8503
Purity>85% (SDS-PAGE)
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Recommended Additive5-50% glycerol (final concentration)
Storage Conditions-20°C/-80°C
Shelf Life (liquid)6 months at -20°C/-80°C
Shelf Life (lyophilized)12 months at -20°C/-80°C
Working Storage4°C for up to one week

How does P. distasonis relate to inflammatory bowel diseases?

P. distasonis has been studied in the context of ulcerative colitis, a form of inflammatory bowel disease. Research has established a relationship between the levels of this bacterium and disease relapse patterns. In one study involving 105 ulcerative colitis patients in remission, a predictive model incorporating demographic information, clinical data, and the levels of Akkermansia muciniphila and P. distasonis was developed to understand remission patterns . The findings revealed a negative correlation between the levels of these two microorganisms and the duration of remission, suggesting their potential role as prognostic markers for disease management .

What therapeutic potential do P. distasonis-derived outer membrane vesicles (Pd-OMVs) show?

P. distasonis-derived outer membrane vesicles (Pd-OMVs) demonstrate significant potential for colon cancer therapy. Research has shown that Pd-OMVs possess potent immunostimulatory effects and exhibit anti-colon tumor properties . In vitro studies have examined the effects of Pd-OMVs on CT26 cell uptake, proliferation, and invasion, while in vivo studies using a CT26 colon tumor model have investigated the anti-colon tumor effects and underlying mechanisms . These findings highlight the potential of Pd-OMVs as a novel approach to cancer immunotherapy.

How are P. distasonis-derived outer membrane vesicles isolated and purified?

The isolation and purification of Pd-OMVs follows a systematic protocol:

  • P. distasonis (ATCC 8503) is subcultured in BHI broth with 150 × g shaking at 37°C for 48 h under anaerobic conditions

  • The cultures are centrifuged twice at 10,000 × g for 20 min at 4°C

  • The supernatant is filtered through a 0.45 μm pore size filter to remove residual bacteria and cellular debris

  • The cell-free filtrate is ultracentrifuged at 150,000 × g for 2 h at 4°C to obtain the Pd-OMVs precipitates

  • For purification, the precipitates are resuspended in sterile phosphate-buffered saline (PBS)

  • The suspension is transferred to ultrafiltration centrifuge tubes (30 kDa) and centrifuged at 8000 × g

This process yields purified Pd-OMVs suitable for experimental studies and potential therapeutic applications.

What are the key catalase properties of P. distasonis and how do they differ from related species?

P. distasonis produces a catalase similar to that of B. fragilis, but notably, the enzyme is twice the size (250,000) . Several variables affect P. distasonis' catalase production, including the type of medium used, the presence of agar, and the addition of hemin either pre- or post-autoclaving. Higher catalase levels are observed after hemin is added post-autoclaving and when the selected medium has a high carbohydrate content . This distinctive catalase property serves as a biochemical marker for identification and differentiation from related species.

Table 2: Comparative Biochemical Features of P. distasonis and Related Species

FeatureP. distasonisBacteroides speciesT. forsythensis
Catalase productionPositive (enzyme size ~250,000)Variable (B. fragilis: positive; B. uniformis: negative)Not specified
Gelatin hydrolysisNegativeVariable (B. ovatus: positive)Not specified
Major menaquinonesMK-9 and MK-10MK-10 and MK-11Not specified
Anteiso-C15:0 to iso-C15:0 ratio3.1 to 10.3Not specified22.8 to 95.2

How can transcriptomic analysis enhance our understanding of P. distasonis interactions with host systems?

Transcriptomic analysis represents a powerful approach to understanding P. distasonis interactions with host systems, particularly in disease contexts. For example, researchers have employed transcriptome analysis of tumor tissues to determine the mechanisms by which Pd-OMVs limit colon tumor growth . This approach allows for comprehensive assessment of gene expression changes in response to bacterial factors, providing insights into the molecular pathways involved in host-microbe interactions.

Key methodological considerations for transcriptomic studies include:

  • RNA extraction protocols optimized for both bacterial and host tissue samples

  • RNA-seq library preparation with appropriate controls

  • Bioinformatic pipelines for differential expression analysis

  • Pathway enrichment and gene ontology analyses

  • Validation of key findings with RT-qPCR or protein-level studies

What are the current challenges in studying the structure-function relationship of uppP enzymes?

Several challenges exist in studying the structure-function relationship of uppP enzymes:

  • As integral membrane proteins, uppP enzymes present difficulties in crystallization for structural determination

  • The hydrophobic nature of the enzymes and their substrates complicates in vitro biochemical assays

  • The essential nature of these enzymes in bacterial survival makes genetic manipulation challenging

  • Limited availability of specific inhibitors hampers functional studies

  • The dynamic nature of enzyme-substrate interactions requires sophisticated biophysical techniques

Despite these challenges, approaches such as computer modeling, molecular dynamics simulations, and site-directed mutagenesis have provided valuable insights into the enzyme's active site and catalytic mechanism .

How might P. distasonis and its enzymes contribute to novel antimicrobial strategies?

Given the essential role of uppP in bacterial cell wall synthesis, this enzyme represents a potential target for novel antimicrobial development. Inhibitors specifically designed against P. distasonis uppP could potentially disrupt bacterial cell wall synthesis. Additionally, the understanding of bacitracin resistance mechanisms mediated by uppP could inform strategies to overcome antimicrobial resistance. Further structural and functional characterization of the enzyme will be crucial for rational drug design efforts.

What potential exists for microbiome-based therapeutic approaches involving P. distasonis?

The ambivalent role of P. distasonis in health and disease suggests significant potential for microbiome-based therapeutic approaches. The probiotic properties of P. distasonis, particularly its protective effects against multiple sclerosis, diabetes, cancer, and Crohn's disease , warrant further investigation for therapeutic applications. The development of P. distasonis-based probiotics or postbiotics could offer novel strategies for managing these conditions. The anti-colon tumor properties of Pd-OMVs also present promising avenues for cancer immunotherapy development.

How can genomic and proteomic approaches advance our understanding of P. distasonis functionality?

Integrated genomic and proteomic approaches offer powerful tools for advancing our understanding of P. distasonis functionality. Comparative genomic analyses across different strains can identify core and accessory genes that contribute to the bacterium's diverse roles in health and disease. Proteomic profiling can reveal the expression patterns of key enzymes like uppP under different conditions, providing insights into regulatory mechanisms. These approaches, combined with metabolomic analyses, can elucidate the functional pathways that underlie P. distasonis' interactions with the host and other microbiota.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.