Recombinant Parabacteroides distasonis UPF0059 membrane protein BDI_0173 (BDI_0173)

Shipped with Ice Packs
In Stock

Description

Research Applications

BDI_0173 is commercially available as a recombinant protein for immunological and biochemical studies. Key applications include:

  • ELISA Development: Used as an antigen to generate antibodies for detecting P. distasonis in clinical samples .

  • Host-Microbe Interaction Studies: Investigated for its role in bacterial adhesion to intestinal epithelial cells, a mechanism linked to commensal colonization .

  • Structural Biology: Serves as a model protein for analyzing membrane protein folding and stability in anaerobic bacteria .

Biological Significance in P. distasonis

P. distasonis exhibits strain-specific interactions with the host, ranging from anti-inflammatory effects to opportunistic pathogenicity . While BDI_0173’s exact role remains under investigation, comparative genomic studies highlight its conservation across P. distasonis strains, suggesting functional importance .

Key Findings:

  • Surface Structure Variability: P. distasonis strains express diverse surface proteins, including fimbriae, pili, and capsular polysaccharides. BDI_0173’s membrane localization positions it as a potential mediator of bacterial adhesion or immune evasion .

  • Immunomodulatory Potential: Outer membrane vesicles (OMVs) from P. distasonis contain membrane-associated proteins like BDI_0173, which may contribute to antitumor immune responses via CXCL10 upregulation .

Limitations and Future Directions

Current research gaps include:

  • Functional Validation: No direct evidence links BDI_0173 to specific probiotic or pathogenic behaviors in P. distasonis.

  • Clinical Relevance: While OMVs containing membrane proteins show antitumor activity , BDI_0173’s contribution to this effect requires mechanistic studies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; BDI_0173; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Target Names
mntP
Target Protein Sequence
MLYIEVLLLAIGLSMDSLAVSVTGGAVLKNNCTAGNIIKIASVLGIFQAGMTVIGYTMGL GFEKYICAFDHWIAFTLLLYLGGKMIYDSTKEEEEDGKFDPLCNRTLCGLGIATSIDALA VGISLAILKSPLLLQASTIGVVTFAISAFGVYFGNRFGKRIDLKLDLIGGLILIGIGTKI LIEHLFFS
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure and characteristics of Parabacteroides distasonis UPF0059 membrane protein BDI_0173?

The BDI_0173 protein is a UPF0059 family membrane protein from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) with Uniprot accession number A6L8E9. The protein consists of 188 amino acids with the following sequence: mLYIEVLLLAIGLSMDSLAVSVTGGAVLKNNCTAGNIIKIASVLGIFQAGMTVIGYTMGLGFEKYICAFDHWIAFTLLLYLGGKMIYDSTKEEEEDGKFDPLCNRTLCGLGIATSIDALAVGISLAILKSPLLLQASTIGVVTFAISAFGVYFGNRFGKRIDLKLDLIGGLILIGIGTKILIEHLFFS .

Methodologically, researchers should note the hydrophobic regions and potential transmembrane domains when designing experiments involving this protein. Analysis using hydropathy plotting and transmembrane prediction algorithms is recommended as a first step when characterizing this protein's structure and potential functional domains.

What are the optimal storage and handling conditions for recombinant BDI_0173 protein preparations?

Recombinant BDI_0173 protein is optimally stored in Tris-based buffer with 50% glycerol at -20°C, or at -80°C for extended storage . For working with the protein, researchers should follow these methodological guidelines:

  • Avoid repeated freeze-thaw cycles as they may compromise protein integrity

  • Prepare working aliquots and store at 4°C for up to one week

  • When handling the protein for experiments, maintain cold chain conditions and use appropriate protease inhibitors

  • Consider the membrane protein nature of BDI_0173 when designing solubilization and reconstitution protocols

These handling procedures are essential for maintaining protein stability and functionality in experimental settings.

How does P. distasonis genomic context inform BDI_0173 research approaches?

P. distasonis possesses a circular 5.39-Mbp chromosome with a G+C content of 44.79% . When designing experiments to study BDI_0173, researchers should consider this genomic context. Methodologically, this involves:

  • Examining flanking genes to identify potential operons or functional gene clusters

  • Considering codon optimization when expressing recombinant forms in heterologous systems

  • Using the G+C content to optimize PCR conditions when amplifying the gene

  • Investigating regulatory elements in the promoter region to understand expression patterns

Understanding this genomic context provides crucial insights for experimental design, particularly for gene expression studies and protein production protocols.

What methodologies are most effective for investigating potential roles of BDI_0173 in autoimmune disease contexts?

Given that P. distasonis has been implicated in various autoimmune conditions, investigating BDI_0173's potential role requires sophisticated methodological approaches:

  • T-cell response assays: Measure T-cell proliferation and cytokine production in response to recombinant BDI_0173 protein, similar to methodologies used in insulin B:9-23 epitope studies

  • Cross-reactivity experiments: Examine potential molecular mimicry between BDI_0173 peptide sequences and host proteins using:

    • Epitope prediction algorithms

    • MHC binding assays

    • Adoptive transfer experiments in appropriate animal models

  • Colonization studies: Utilize gnotobiotic animal models with defined P. distasonis strains (wild-type versus BDI_0173 knockout) to assess disease progression, as demonstrated in NOD mouse models for diabetes research

These methodologies can help elucidate whether BDI_0173 contributes to P. distasonis' reported roles in multiple sclerosis, diabetes, cancer, and Crohn's disease .

What experimental approaches can resolve contradictory findings regarding P. distasonis membrane proteins in disease modulation?

Research indicates that P. distasonis can have both protective and pathogenic roles in various conditions . When examining contradictory findings related to BDI_0173, researchers should implement these methodological strategies:

  • Context-dependent analysis: Investigate BDI_0173 expression and function under various environmental conditions that might influence P. distasonis behavior:

    • Oxygen levels (considering P. distasonis is aerotolerant despite being anaerobic)

    • pH variations

    • Nutrient availability

    • Presence of specific host factors

  • Strain-specific comparative studies: Compare BDI_0173 sequence and expression across different P. distasonis strains associated with different disease outcomes

  • Systematic mutagenesis: Create BDI_0173 variants to identify specific domains responsible for beneficial versus pathogenic effects

  • Time-course experiments: Analyze BDI_0173 expression and function across developmental phases of the host, as P. distasonis has shown different impacts depending on colonization timing

How can researchers effectively characterize the structure-function relationship of BDI_0173?

To elucidate structure-function relationships of this membrane protein, implement these methodological approaches:

  • Protein structure determination:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR for specific domains

    • In silico molecular modeling based on the known amino acid sequence

  • Site-directed mutagenesis targeting:

    • Predicted transmembrane regions

    • Potential ligand-binding sites

    • Conserved residues across UPF0059 family proteins

  • Functional assays:

    • Membrane integration studies

    • Ion or solute transport measurements

    • Protein-protein interaction analyses

    • Host cell response assays

What controls are essential for experiments involving recombinant BDI_0173?

When designing experiments with recombinant BDI_0173, include these methodological controls:

  • Positive controls:

    • Well-characterized membrane proteins from the same family

    • Native BDI_0173 isolated from P. distasonis when feasible

  • Negative controls:

    • Buffer-only conditions

    • Irrelevant recombinant proteins with similar purification tags

    • Heat-denatured BDI_0173 to distinguish structural vs. sequence-specific effects

  • Expression system controls:

    • Empty vector controls

    • Host cells without the expression vector

  • For immunological studies:

    • Unrelated bacterial peptides

    • Host-derived peptides with similar physicochemical properties

These controls help distinguish specific BDI_0173 effects from non-specific experimental artifacts.

What considerations should guide the selection of expression systems for recombinant BDI_0173 production?

Selecting appropriate expression systems for BDI_0173 requires careful methodological consideration:

  • Prokaryotic systems:

    • E. coli-based systems may provide high yields but might not properly fold membrane proteins

    • Consider specialized E. coli strains designed for membrane protein expression

    • Codon optimization based on P. distasonis' 44.79% G+C content

  • Eukaryotic systems:

    • Yeast systems like Pichia pastoris may provide better membrane protein folding

    • Insect cell systems for complex membrane proteins requiring eukaryotic processing

  • Cell-free systems:

    • Allow controlled environment for membrane protein synthesis

    • Enable incorporation of non-standard amino acids for structure-function studies

  • Purification strategy considerations:

    • Detergent selection critically impacts membrane protein stability and function

    • Tag placement (N- or C-terminal) may affect protein folding and function

Each system presents distinct advantages and limitations for membrane protein expression that should be evaluated based on experimental goals.

How should researchers address variability in experimental outcomes with BDI_0173?

Variability in BDI_0173 experiments may stem from multiple sources that require methodological solutions:

  • Protein preparation variability:

    • Implement rigorous quality control measures including SDS-PAGE, Western blotting, and mass spectrometry

    • Quantify protein concentration using multiple methods (Bradford, BCA, UV absorbance)

    • Verify proper folding using circular dichroism spectroscopy

  • Experimental condition standardization:

    • Maintain consistent buffer conditions, particularly pH and ionic strength

    • Document and control temperature fluctuations

    • Standardize incubation times precisely

  • Biological variability considerations:

    • Use sufficient biological and technical replicates (minimum n=3 for each)

    • Apply appropriate statistical methods for membrane protein research

    • Consider sex-based differences, as P. distasonis shows sex-specific effects in some models

  • Data analysis approaches:

    • Employ blinded analysis when possible

    • Use bootstrapping or other resampling methods for robust statistical inference

    • Consider Bayesian approaches for integrating prior knowledge with new data

What are common technical challenges when working with BDI_0173 and their solutions?

Researchers frequently encounter these technical challenges with membrane proteins like BDI_0173:

ChallengeMethodological Solution
Poor solubilityOptimize detergent selection; try different detergent classes; consider amphipols or nanodiscs for reconstitution
Low expression yieldTest multiple expression systems; optimize induction conditions; consider fusion partners to enhance expression
Protein aggregationAdjust buffer conditions; include stabilizing agents; optimize protein concentration
Functional assay limitationsDevelop reconstituted systems; consider whole-cell assays; implement label-free interaction studies
Inconsistent purificationStandardize lysis procedures; optimize tag position; employ size exclusion chromatography as final purification step

For each challenge, systematic optimization and detailed documentation of conditions are essential for reproducible outcomes.

How might BDI_0173 contribute to P. distasonis' dual roles in health and disease?

P. distasonis demonstrates both protective and pathogenic roles in various conditions . Future research into BDI_0173's contribution should methodologically address:

  • Temporal expression patterns:

    • Investigate BDI_0173 expression across developmental phases, considering findings that P. distasonis has different impacts depending on colonization timing

    • Develop time-course experimental designs that track both expression and host response

  • Interactome mapping:

    • Identify host proteins that interact with BDI_0173

    • Characterize potential signaling pathways activated by these interactions

    • Establish causality between specific interactions and downstream health effects

  • Structure-based therapeutic approaches:

    • Design peptide antagonists based on BDI_0173 structure

    • Develop antibodies targeting specific epitopes

    • Explore small molecule modulators of BDI_0173 function

  • Microbiome context:

    • Investigate how the presence of other microbiota members influences BDI_0173 expression and function

    • Study metabolic products that may regulate BDI_0173 activity

What emerging technologies will advance our understanding of BDI_0173 function?

Several cutting-edge methodological approaches show promise for advancing BDI_0173 research:

  • Single-cell techniques:

    • Apply single-cell RNA-seq to understand heterogeneity in P. distasonis populations

    • Use single-cell proteomics to detect variable BDI_0173 expression

  • Advanced imaging:

    • Implement super-resolution microscopy to visualize BDI_0173 localization

    • Apply correlative light and electron microscopy for structural-functional insights

  • Computational approaches:

    • Utilize machine learning for prediction of BDI_0173 interactions

    • Apply molecular dynamics simulations to understand membrane integration and protein flexibility

  • Gene editing technologies:

    • Implement CRISPR-Cas systems adapted for P. distasonis to create precise genetic modifications

    • Develop conditional knockout systems to study temporal aspects of BDI_0173 function

These emerging technologies will help address currently unresolved questions about BDI_0173's fundamental biology and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.