Recombinant Parabacteroides distasonis UPF0365 protein BDI_2116 (BDI_2116)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; BDI_2116; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
full length protein
Species
Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Target Names
BDI_2116
Target Protein Sequence
MEITFLPLILLGAAVLLLAIFFYYVPFLLWISAKVSGVNISLIQLFLMRIRKVPPYIITR AMIEAHKAGIKTLTRDELEAHYLAGGHVEKVVHALVSASKANIDLPFQMATAIDLAGRDV FEAVQMSVNPKVIDTPPVTAVAKDGIQLIAKARVTVRANIKQLVGGAGEETILARVGEGI VSSIGSSESHKTVLENPDSISKLVLRKGLDAGTAFEILSIDIADIDIGKNIGAFLQMDQA QADKNIAQAKAEERRAMAVALEQEMKAKAQEARAKVIEAEAEVPKAMADAFRTGNLGVMD YYKMKNIEADTSMREAIAKPTGAPSKPLKD
Uniprot No.

Target Background

Function

Recombinant Parabacteroides distasonis UPF0365 protein BDI_2116 (BDI_2116) is found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. These FMMs are highly dynamic structures whose numbers increase with cellular aging. Flotillins are considered crucial for maintaining membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

Methodological Approach to Recombinant BDI_2116 Production:

The recombinant BDI_2116 protein is typically produced using E. coli expression systems, with the following standard protocol:

  • Gene Cloning: The BDI_2116 gene sequence (coding for amino acids 1-330) is amplified from P. distasonis genomic DNA and cloned into a suitable expression vector containing an N-terminal His-tag sequence.

  • Expression System: Transformation into competent E. coli cells, with expression typically induced using IPTG or auto-induction media under optimized conditions.

  • Purification Process:

    • Initial clarification of cell lysate by centrifugation

    • Affinity chromatography using Ni-NTA resin to capture the His-tagged protein

    • Optional additional purification steps such as ion exchange or size exclusion chromatography

    • Final quality assessment by SDS-PAGE with >90% purity standard

  • Post-purification Processing:

    • Buffer exchange into Tris-based storage buffer

    • Concentration determination

    • Addition of stabilizers (typically 50% glycerol or 6% trehalose)

    • Lyophilization or storage as liquid formulation

This standardized approach enables consistent production of research-grade recombinant protein while maintaining structural integrity and functional properties.

Critical Handling Parameters for Optimal Experimental Outcomes:

  • Reconstitution Protocol:

    • Brief centrifugation of the vial before opening is recommended to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to a final concentration of 50% (or as recommended for specific experiments)

  • Storage Conditions:

    • Store lyophilized powder at -20°C/-80°C

    • For reconstituted protein, store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this significantly impacts protein integrity

  • Buffer Compatibility Assessment:

    • Standard storage buffer contains Tris/PBS with 6% trehalose at pH 8.0

    • When changing buffers for specific applications, gradual dialysis is recommended to maintain protein stability

    • Document any precipitation or changes in solution clarity during buffer transitions

  • Quality Control Parameters:

    • Verify protein integrity by SDS-PAGE before experimental use

    • For functional studies, preliminary activity assessments should be conducted to establish baseline parameters

    • Consider time-dependent stability studies if experiments extend over multiple days

These methodological considerations help ensure experimental reproducibility and reliability when working with this protein in research settings.

How does P. distasonis strain variability impact the structure and function of BDI_2116 protein in research applications?

Strain variability in P. distasonis significantly impacts research outcomes when working with BDI_2116 and related proteins. Current genomic analyses have revealed substantial heterogeneity among P. distasonis strains that directly affects membrane proteins and surface structures.

Strain-Dependent Variations Affecting BDI_2116:

This strain variability has significant implications for research reliability and reproducibility, particularly when studying membrane-associated proteins like BDI_2116 in host-microbe interaction models.

Methodological Framework for Immune Interaction Studies:

  • In Vitro Cellular Models:

    • Human intestinal epithelial cell lines (Caco-2, HT-29) for barrier function studies

    • Macrophage cell lines (THP-1, RAW264.7) for innate immune response assessment

    • Co-culture systems combining epithelial and immune cells to model complex interactions

    • Measurement parameters should include cytokine production profiles, barrier integrity markers, and transcriptomic responses

  • Ex Vivo Approaches:

    • Intestinal organoid cultures derived from murine or human samples

    • Precision-cut intestinal slices maintaining tissue architecture

    • Primary immune cell isolates for direct interaction studies

    • These systems better recapitulate physiological complexity while allowing controlled experimental manipulation

  • In Vivo Models:

    • Gnotobiotic mouse models allowing controlled colonization

    • NOD (non-obese diabetic) mice for autoimmunity studies

    • Assessment of intraepithelial lymphocyte populations, T-helper cells, and B-cell responses

    • Monitoring of specific immune markers such as IL-15 levels

  • Single Subject Experimental Design Considerations:

    • For in vivo studies, implementing withdrawal designs (A-B-A) or multiple baseline designs

    • Ensuring proper controls where subjects serve as their own comparators

    • Establishing prediction, verification, and replication parameters

    • These designs are particularly valuable when studying host-specific immune responses to bacterial proteins

This methodological framework provides a comprehensive approach to understanding BDI_2116 interactions with host immune systems across multiple experimental scales.

How does the rfbA-typing classification system relate to studies of BDI_2116 and other membrane-associated proteins in P. distasonis?

The rfbA-typing classification system is a crucial genomic framework that contextualizes the study of membrane-associated proteins like BDI_2116 in P. distasonis. This classification has direct implications for understanding the bacterium's surface architecture and host interactions.

Relationship Between rfbA-Typing and BDI_2116 Function:

  • Genomic Classification System:

    • The rfbA gene encodes glucose-1-phosphate thymidylyltransferase, a key enzyme in O-antigen synthesis

    • P. distasonis strains are classified into five distinct rfbA-Types (I-V) based on gene sequence variations

    • These classifications correlate with different lipopolysaccharide (LPS) structures that interface with membrane proteins

  • Functional Implications for BDI_2116 Studies:

    • BDI_2116, as a membrane-associated protein, likely interacts with LPS components

    • Different rfbA-Types create distinct membrane environments that may alter BDI_2116 orientation, accessibility, or function

    • Researchers should document rfbA-Type when studying BDI_2116 to account for these potential interactions

  • Pathogenicity Correlations:

    • rfbA-Type I is associated with many potentially pathogenic P. distasonis strains

    • These strain differences may influence whether BDI_2116 contributes to probiotic effects or pathogenic potential

    • Differential immune recognition of BDI_2116 may be partially dependent on the surrounding LPS context defined by rfbA-Type

Understanding the rfbA-type of the specific P. distasonis strain is therefore essential when designing experiments to study BDI_2116, as it provides critical context for interpreting results related to membrane protein function and host interactions.

What is the potential role of BDI_2116 in P. distasonis-mediated effects on autoimmune conditions like Type 1 Diabetes?

Current research suggests complex relationships between P. distasonis proteins and autoimmune conditions, particularly Type 1 Diabetes (T1D). While specific functions of BDI_2116 in this context require further investigation, the broader context of P. distasonis membrane proteins in autoimmunity provides important research directions.

Potential Mechanisms in Autoimmune Modulation:

  • Molecular Mimicry Pathway:

    • P. distasonis contains proteins with sequence similarity to insulin B:9-23 (insB:9-23), a key autoantigen in T1D

    • Specifically, the hypoxanthine phosphoribosyltransferase (hprt) protein contains a mimic (hprt4-18) that activates insB:9-23-specific T-cells

    • P. distasonis colonization in female NOD mice enhanced diabetes onset through this molecular mimicry mechanism

  • Altered Immune Cell Populations:

    • P. distasonis colonization significantly affects intraepithelial lymphocytes (IELs) in NOD mice

    • Documented 1.72-fold reduction in T-helper cells and 2.3-fold reduction in T-effector cells

    • B-cell populations showed a 1.85-fold reduction

    • These alterations could potentially involve membrane proteins like BDI_2116, though direct evidence is still emerging

  • Research Approach for BDI_2116 in Autoimmunity:

    • Comparative studies between BDI_2116 and known immunomodulatory proteins

    • Investigation of potential sequence homology between BDI_2116 fragments and host autoantigens

    • Assessment of BDI_2116 in gnotobiotic models to isolate its specific effects from whole-bacteria effects

    • Examination of whether BDI_2116 alters gut permeability or cytokine production

This research direction has significant implications for understanding how specific bacterial proteins may contribute to either protective or pathogenic effects in autoimmune conditions.

Comprehensive Structural Biology Workflow:

  • Preliminary Computational Analysis:

    • Homology modeling based on related UPF0365 family proteins

    • Secondary structure prediction using machine learning algorithms

    • Molecular dynamics simulations to predict membrane interactions

    • These approaches provide initial structural hypotheses to guide experimental design

  • Experimental Structure Determination Hierarchy:

    TechniqueResolutionSample RequirementsAdvantagesLimitations
    X-ray Crystallography1-3Å5-10mg of highly pure protein, diffraction-quality crystalsAtomic-level detail, visualizes bound cofactorsCrystallization challenges for membrane proteins
    Cryo-Electron Microscopy2-4Å100μg of pure protein, vitrified samplesWorks with larger complexes, no crystallization neededEquipment access limitations, lower resolution for small proteins
    NMR SpectroscopyAtomic models15N/13C labeled protein (2-5mg)Solution dynamics, binding interactionsSize limitations, extensive data analysis
    Small-Angle X-ray ScatteringLow resolution envelopes50-100μg protein in solutionNative conditions, minimal sample preparationLimited resolution, shape information only
  • Membrane Protein-Specific Considerations:

    • Detergent screening to identify optimal solubilization conditions

    • Nanodiscs or amphipol reconstitution for near-native environment studies

    • Use of lipid cubic phase crystallization for membrane-embedded regions

    • These specialized approaches address the particular challenges of membrane-associated proteins like BDI_2116

  • Integrative Structural Biology:

    • Combining multiple techniques (e.g., crystallography with molecular dynamics)

    • Cross-validation of structural models across methods

    • Correlation with functional assays to validate structural findings

    • This integrated approach provides the most comprehensive structural characterization

This methodological framework addresses the unique challenges posed by membrane-associated bacterial proteins like BDI_2116 while maximizing structural information obtained.

Systematic Experimental Approach for Immune Receptor Interactions:

  • Receptor Candidate Identification:

    • In silico analysis to predict potential interactions between BDI_2116 and pattern recognition receptors (PRRs)

    • Focus on Toll-like receptors (particularly TLR2 and TLR4) given their role in bacterial membrane component recognition

    • Consider NOD-like receptors and C-type lectin receptors as additional candidates

    • This predictive approach narrows down experimental targets

  • Direct Binding Assays:

    • Surface plasmon resonance (SPR) with immobilized receptors and varying concentrations of purified BDI_2116

    • Microscale thermophoresis for solution-based interaction studies

    • Co-immunoprecipitation assays from cell lysates following exposure to tagged BDI_2116

    • These methods provide quantitative binding parameters (Kd, kon, koff) to characterize interactions

  • Cellular Activation Studies:

    • Reporter cell lines expressing individual PRRs (e.g., HEK-Blue™ cells)

    • Dose-response measurements of receptor activation following BDI_2116 exposure

    • Competitive inhibition assays with known ligands to confirm specificity

    • Assessment of downstream signaling pathway activation (NF-κB, IRF3, MAPK)

    • These functional assays connect binding events to biological responses

  • Validation in Knockout/Knockdown Systems:

    • Studies in receptor-deficient cell lines or primary cells from knockout mice

    • siRNA-mediated knockdown of candidate receptors

    • Rescue experiments with receptor re-expression

    • These approaches establish causality between specific receptors and BDI_2116 responses

  • Context-Dependent Modulation:

    • Evaluation of how rfbA-type impacts BDI_2116-receptor interactions

    • Assessment of interactions in different inflammatory environments

    • Examination of species-specific receptor recognition patterns

    • These contextual studies address the complexity of host-microbe interactions

This comprehensive experimental framework enables systematic characterization of BDI_2116 interactions with host immune receptors while accounting for biological complexity.

Advanced Comparative Genomics Framework:

  • Phylogenetic Profiling Strategy:

    • Identify BDI_2116 homologs across Bacteroidetes and related phyla

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Map presence/absence patterns to bacterial phenotypes

    • This approach reveals evolutionary conservation and potential functional importance

  • Synteny Analysis Methodology:

    • Examine gene neighborhood conservation around BDI_2116 homologs

    • Identify co-evolved gene clusters that may indicate functional relationships

    • Compare operonic structures across species

    • These patterns often indicate functional protein interactions or related metabolic pathways

  • Structural Variation Assessment:

    • Compare protein domain architectures across homologs

    • Identify species-specific insertions, deletions, or rearrangements

    • Correlate structural variations with niche adaptations

    • This structure-function relationship analysis highlights adaptively important regions

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios across protein-coding sequences

    • Identify regions under purifying vs. diversifying selection

    • Correlate selection patterns with predicted functional domains

    • These evolutionary signatures indicate functionally critical regions

  • Data Integration Table Example:

    SpeciesBDI_2116 HomologIdentity (%)Syntenic ContextSelective PressureAssociated Phenotype
    P. distasonis ATCC 8503BDI_2116100ReferenceBaselineCore reference strain
    P. distasonis CavFT-hAR46Homolog ID96.4ConservedPurifying (dN/dS=0.11)Associated with Crohn's disease
    P. merdaeHomolog ID78.2Partial conservationMixed (dN/dS=0.48)Commensal gut bacterium
    Bacteroides fragilisHomolog ID52.8DivergentDiversifying in surface-exposed regionsOpportunistic pathogen
    Alistipes putredinisHomolog ID45.3Minimal conservationStrong divergenceDifferent ecological niche

This systematic comparative genomics approach provides a comprehensive framework for understanding BDI_2116 evolution and functional adaptation across Bacteroidetes, generating hypotheses for targeted experimental validation.

Optimized Single-Subject Experimental Design Framework:

When studying effects of recombinant BDI_2116 in animal models, the selection of appropriate single-subject experimental designs is crucial for establishing experimental control while addressing ethical considerations.

  • Reversal/Withdrawal Design (A-B-A):

    • Implementation: Baseline measurements (A), BDI_2116 administration period (B), return to baseline conditions (A)

    • Analysis: Visual and statistical analysis of changes between phases

    • Advantages: Clear demonstration of experimental control

    • Limitations: Ethical concerns if BDI_2116 produces beneficial effects that are then withdrawn

    • Appropriate scenarios: Initial proof-of-concept studies where effects are expected to be reversible and non-critical

  • Multiple Baseline Design:

    • Implementation: Staggered introduction of BDI_2116 across multiple subjects, behaviors, or settings

    • Analysis: Demonstration of effect only when intervention is applied to each specific baseline

    • Advantages: No withdrawal required, strong internal validity

    • Applications:

      • Across subjects: Testing BDI_2116 in different animals sequentially

      • Across behaviors: Assessing effects on multiple physiological parameters

      • Across settings: Evaluating responses in different environmental conditions

    • Recommended scenarios: Studies where withdrawal is problematic or when testing multiple outcome measures

  • Changing Criterion Design:

    • Implementation: Gradual adjustment of BDI_2116 dosage or exposure in predetermined steps

    • Analysis: Correlation between criterion changes and measured responses

    • Advantages: Demonstrates dose-dependent relationships

    • Applications: Dose-finding studies, tolerance development assessment

    • Preferred contexts: When studying graduated responses or developing optimal dosing regimens

  • Alternating Treatment Design:

    • Implementation: Rapid alternation between BDI_2116 treatment and control or between different BDI_2116 variants

    • Analysis: Direct comparison of effects under different conditions

    • Advantages: Efficient comparison of multiple treatment options

    • Applications: Comparing different BDI_2116 formulations or administration routes

    • Ideal use: Comparative efficacy studies when carryover effects are minimal

This framework ensures that researchers select the most appropriate single-subject design based on the specific characteristics of their BDI_2116 research questions, ethical considerations, and practical constraints.

Methodological Framework for Resolving Research Contradictions:

The scientific literature presents contradictory findings regarding P. distasonis, with some studies characterizing it as beneficial while others identify pathogenic potential. These contradictions extend to membrane proteins like BDI_2116. The following framework provides a systematic approach to analyzing and resolving such conflicting evidence:

  • Strain-Specific Analysis:

    • Methodology: Compare experimental results across studies using identical P. distasonis strains

    • Documentation: Create a comparative table of studies grouped by specific strain identifiers

    • Interpretation Tool: Attribute contradictions to strain differences when results diverge between strains

    • Application: Studies showing P. distasonis ATCC 8503 demonstrating probiotic effects may not be generalizable to clinical isolates like CavFT-hAR46 associated with Crohn's disease

  • Context-Dependent Effects Assessment:

    • Approach: Evaluate host factors and environmental conditions across contradictory studies

    • Parameters to Compare: Host genetic background, disease status, microbiome composition

    • Analysis Method: Identify interaction effects between these factors and P. distasonis/BDI_2116

    • Example Application: P. distasonis colonization may have different effects in NOD mice (enhancing autoimmunity) versus obese models (beneficial metabolic effects)

  • Methodological Heterogeneity Evaluation:

    • Process: Systematically compare experimental methodologies across contradictory studies

    • Focus Areas: Protein preparation methods, dose/concentration, administration route, outcome measures

    • Resolution Tool: Meta-analysis techniques that account for methodological differences

    • Practical Application: Contradictions may arise from differences in protein purity or presence of contaminating components

  • Molecular Mechanism Discrimination:

    • Approach: Distinguish direct effects of BDI_2116 from indirect effects mediated through microbiome changes

    • Experimental Design: Compare germ-free models (direct effects) versus conventional models (combined effects)

    • Analysis Technique: Pathway analysis to identify distinct molecular mechanisms

    • Example Finding: P. distasonis colonization minimally impacts gut microbiome composition (altering only 28 ASVs) while still enhancing diabetes onset, suggesting direct immunomodulatory mechanisms

  • Integration Framework:

    • Method: Develop a unified conceptual model that accommodates seemingly contradictory findings

    • Tool: Decision tree for predicting beneficial versus pathogenic effects based on key variables

    • Analytical Approach: Bayesian network analysis incorporating conditional probabilities

    • Expected Outcome: Identification of specific conditions under which P. distasonis and BDI_2116 exhibit either beneficial or pathogenic properties

This comprehensive analytical framework enables researchers to resolve apparent contradictions in the literature by systematically accounting for biological complexity and methodological differences, advancing our understanding of the dual nature of P. distasonis and its membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.