Recombinant Paracentrotus lividus Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Paracentrotus lividus (Common sea urchin)
Target Names
COII
Target Protein Sequence
MATWAQFGLQDASSPLMEELTYFHDYALIVLTLITILVFYGLVSLLLSSSTNRFFLEGQE LETIWTVVPAFILIFIALPSLQLLYLMDEVNNPFLTIKAIGHQWYWSYEYTDYNDLEFDS YMVPTSDVSLGNPRLLEVDNRLILPMQNPIRVLVSSADVLHSWAVPSLGVKMDAVPGRLN QTTFFAARAGLFYGQCSEICGANHSFMPILIESVPFSNFENWVAQYIEE
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaboratively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center (subunit 2) and heme A (subunit 1) to the active site's binuclear center (BNC), consisting of heme A3 and CuB (subunit 1). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Cytochrome c Oxidase Subunit 2 in Paracentrotus lividus?

Cytochrome c oxidase subunit 2 (COII) in P. lividus functions as a critical component of the mitochondrial electron transport chain. Similar to COII in other organisms, it is directly responsible for the initial transfer of electrons from cytochrome c to the cytochrome c oxidase (COX) complex, which is crucial for ATP production during cellular respiration . This highly conserved protein contains copper-binding sites that facilitate electron transfer and contributes to the proton gradient across the inner mitochondrial membrane. In P. lividus, this energy production system supports its developmental processes and ecological adaptations to Mediterranean environments.

How does COII sequence variation compare between populations of Paracentrotus lividus?

While specific COII variation in P. lividus isn't directly reported in available studies, mitochondrial gene analysis of this sea urchin reveals important patterns applicable to COII. Population genetic studies of P. lividus using mitochondrial markers have shown:

These patterns suggest that COII would likely show similar population structure, providing insights into the evolution and adaptation of respiratory function across the species' range.

What methodological approaches are recommended for isolating COII gene sequences from P. lividus samples?

To successfully isolate COII gene sequences from P. lividus samples, researchers should follow this methodological workflow:

  • Collect fresh tissue samples (preferably gonad or tube feet) and preserve in 95% ethanol or flash-freeze

  • Extract total genomic DNA using established protocols for marine invertebrates

  • Design PCR primers targeting conserved regions flanking the COII gene based on published sea urchin mitochondrial genomes

  • Amplify the COII gene using optimized PCR conditions (typically including:

    • Initial denaturation at 94°C for 3 minutes

    • 35 cycles of: 94°C for 30s, 50-55°C for 45s, 72°C for 1 minute

    • Final extension at 72°C for 10 minutes)

  • Verify amplification via gel electrophoresis and purify PCR products

  • Sequence using Sanger or next-generation sequencing methods

  • Align sequences with published echinoderm COII sequences for verification

This approach has proven effective for amplifying other mitochondrial genes in P. lividus and can be adapted specifically for COII.

How can researchers detect selection pressure on COII in Paracentrotus lividus populations?

To detect selection pressure on COII in P. lividus populations, researchers should implement these analytical approaches:

  • Sequence the COII gene from multiple individuals across different populations

  • Calculate the ratio of nonsynonymous to synonymous substitutions (ω or dN/dS) using maximum likelihood models of codon substitution

  • Apply site-specific models to identify codons under purifying (ω << 1), neutral (ω = 1), or positive selection (ω > 1)

  • Implement branch-site models to detect lineage-specific selection in particular populations

  • Conduct McDonald-Kreitman tests to compare the ratio of nonsynonymous to synonymous substitutions within and between species

These methods have revealed that in other marine invertebrates like Tigriopus californicus, the majority of COII codons are under strong purifying selection, while approximately 4% evolve under relaxed selective constraint . Similar patterns might be expected in P. lividus, potentially with population-specific selection signatures reflecting local adaptation.

How does the genetic structure of COII compare with other mitochondrial genes used in P. lividus population studies?

Based on studies of mitochondrial genetics in P. lividus, researchers should consider these comparative aspects when analyzing COII:

  • COI has shown higher variability and discriminatory power than Cytb in P. lividus population studies

  • Mitochondrial markers have identified 3-4 distinct haplogroups occurring at different frequencies across the Mediterranean and Atlantic

  • The bimodal mismatch distributions observed in P. lividus mitochondrial genes suggest either population stability or contact between different populations

  • Neutrality tests (such as Fu's Fs) on combined wild population data indicate past expansion or bottleneck recovery

When analyzing COII in comparison to other mitochondrial markers, researchers should expect similar patterns of differentiation but should also be alert to gene-specific evolutionary rates and selection pressures that might lead to different population structure signals.

What implications do interpopulation genetic differences have for recombinant expression of COII from different P. lividus sources?

Interpopulation genetic differences in P. lividus can significantly impact recombinant COII expression and function:

  • Nonsynonymous substitutions in functional domains may alter protein folding, stability, or activity

  • Population-specific variants might show differential compatibility with expression systems

  • Codon usage bias differences between populations could affect translation efficiency in heterologous systems

  • Genetic differentiation between Atlantic and Mediterranean populations may result in functionally distinct COII variants

  • Recombinant proteins from divergent populations may exhibit differences in:

    • Electron transfer efficiency

    • Thermal stability

    • pH optimum

    • Interaction with nuclear-encoded components

Researchers should carefully document the source population of their COII sequence and consider how population-specific variations might influence experimental outcomes and interpretations.

What expression systems are most effective for producing functional recombinant P. lividus COII?

The optimal expression system for recombinant P. lividus COII depends on research objectives and downstream applications. Each system offers distinct advantages:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coli- High yield
- Simple setup
- Low cost
- Rapid growth
- Limited post-translational modifications
- Membrane protein folding challenges
- Inclusion body formation
- Structural studies
- Antibody production
- Protein interaction studies
Yeast (P. pastoris)- Eukaryotic processing
- High density cultures
- Secretion possible
- Better folding
- Longer development time
- Hyperglycosylation
- Lower yield than E. coli
- Functional studies
- Enzymatic assays
- Protein-protein interactions
Insect cells- Near-native folding
- Proper post-translational modifications
- Good for membrane proteins
- Higher cost
- Technical complexity
- Slower process
- Activity studies
- Structural biology
- Complex formation analysis
Cell-free systems- Rapid expression
- Membrane protein friendly
- No toxicity concerns
- Limited scale
- High cost
- Technical challenges
- Toxic protein expression
- Rapid screening
- Incorporation of nonstandard amino acids

For membrane proteins like COII, insect cell systems often provide the best balance of proper folding and reasonable yield, while E. coli systems with specialized strains designed for membrane proteins can be cost-effective alternatives.

What purification strategies yield the highest activity retention for recombinant P. lividus COII?

To obtain highly active recombinant P. lividus COII, researchers should implement this optimized purification workflow:

  • Extraction: Employ gentle solubilization using mild detergents

    • n-Dodecyl β-D-maltoside (DDM) at 1-2% (w/v)

    • Digitonin at 0.5-1% (w/v)

    • CHAPS at 0.5-1% (w/v)

  • Initial Purification: Utilize affinity chromatography

    • His-tag purification with imidazole gradients (10-250 mM)

    • Maintain detergent above critical micelle concentration

    • Include glycerol (10-15%) for stability

  • Secondary Purification: Apply size exclusion chromatography

    • Reduces detergent concentration

    • Separates monomeric from aggregated protein

    • Buffers should contain reduced detergent levels (0.05-0.1%)

  • Activity Preservation Factors:

    • Maintain Cu²⁺ availability (1-5 µM CuSO₄)

    • Include reducing agents (1-5 mM β-mercaptoethanol)

    • Control pH (typically 7.0-7.5)

    • Add stabilizing agents (glycerol, sucrose)

    • Perform all steps at 4°C

  • Storage Conditions:

    • Flash-freeze in liquid nitrogen

    • Store at -80°C in small aliquots

    • Include cryoprotectants (15-20% glycerol)

This integrated approach prioritizes retention of the native membrane environment while removing contaminants, essential for maintaining the electron transfer capability of this respiratory chain component.

How can researchers verify the functional integrity of recombinant P. lividus COII?

Verification of recombinant P. lividus COII functional integrity requires multiple complementary approaches:

  • Spectroscopic Analysis:

    • UV-Visible spectroscopy to confirm characteristic absorption peaks of heme and copper centers

    • Circular dichroism to verify secondary structure elements

    • Fluorescence spectroscopy to assess tertiary structure integrity

  • Enzymatic Activity Assays:

    • Oxygen consumption measurements using polarographic electrodes

    • Cytochrome c oxidation rates (decrease in absorbance at 550 nm)

    • Electron transfer efficiency using artificial electron donors/acceptors

  • Structural Verification:

    • Western blotting with antibodies against conserved epitopes

    • Mass spectrometry to confirm molecular weight and modifications

    • Limited proteolysis to assess folding quality

  • Thermal Stability Assessment:

    • Differential scanning calorimetry to determine melting temperature

    • Thermal shift assays to measure stability across temperature ranges

    • Activity retention after controlled thermal challenge

  • Interaction Analysis:

    • Co-immunoprecipitation with other cytochrome oxidase components

    • Surface plasmon resonance to measure binding kinetics

    • Reconstitution into liposomes to assess membrane integration

Researchers should prioritize activity-based assays rather than relying solely on structural integrity to confirm that the recombinant protein retains its electron transfer capabilities.

How can recombinant P. lividus COII be used to study mitonuclear compatibility in hybrid populations?

Recombinant P. lividus COII offers powerful approaches for investigating mitonuclear compatibility in hybrid populations:

  • Comparative Activity Analysis:

    • Express COII variants from different populations

    • Measure electron transfer efficiency when paired with nuclear-encoded components from same vs. different populations

    • Quantify activity differences to assess compatibility

  • Interspecific Hybrid Analysis:

    • Create chimeric COII proteins with domains from different populations

    • Identify critical regions responsible for compatibility with nuclear components

    • Test functional consequences of naturally occurring variants

  • Experimental Design Framework:

    • Step 1: Clone COII from multiple populations with known genetic differentiation

    • Step 2: Express recombinant variants with standardized tags/fusion partners

    • Step 3: Reconstitute with nuclear-encoded components in controlled ratios

    • Step 4: Measure activity parameters across combinations

    • Step 5: Correlate functional differences with genetic divergence

This approach builds on observations from other species like Tigriopus californicus, where codons in COII may undergo positive selection to compensate for amino acid substitutions in nuclear-encoded subunits , potentially explaining hybrid breakdown in interpopulation crosses.

What experimental designs best address the co-evolution of mitochondrial and nuclear genes in P. lividus?

To investigate mitochondrial-nuclear co-evolution in P. lividus, researchers should implement these experimental approaches using recombinant COII:

  • Reciprocal Expression Studies:

    • Express COII variants from Atlantic and Mediterranean populations

    • Test functionality with nuclear components from both sources

    • Measure fitness consequences through activity assays

    • Quantify compatibility differences across population combinations

  • Molecular Evolution Analysis:

    • Compare rates of evolution between COII and its nuclear interaction partners

    • Identify co-evolving amino acid positions using statistical coupling analysis

    • Test the functional consequences of correlated substitutions

  • Experimental Evolution Framework:

    • Create mixed populations with different mitochondrial-nuclear combinations

    • Subject to selection under controlled conditions

    • Track changes in allele frequencies over generations

    • Identify compensatory mutations that restore function

  • Structural Biology Approach:

    • Generate structural models of COII-nuclear protein interfaces

    • Map population-specific variations onto interaction surfaces

    • Test predictions about compatibility through site-directed mutagenesis

    • Verify structure-function relationships experimentally

This multi-faceted approach can reveal how population-specific variations in mitochondrial genes like COII co-evolve with nuclear partners to maintain optimal respiratory function across the species' range.

How might P. lividus COII sequence variation correlate with environmental adaptation across its distribution range?

The correlation between P. lividus COII sequence variation and environmental adaptation can be investigated through these methodological approaches:

  • Environmental Association Analysis:

    • Sequence COII from populations across environmental gradients

    • Correlate nonsynonymous substitutions with parameters such as:

      • Temperature range

      • Oxygen availability

      • Salinity fluctuations

      • Pollution levels

    • Test for significant associations using statistical methods that account for population structure

  • Functional Characterization of Variants:

    • Express recombinant COII variants from populations in different environments

    • Measure enzymatic activity under varying conditions mimicking natural habitats

    • Compare thermal stability, pH optima, and oxygen affinity across variants

  • Selection Analysis Framework:

    • Apply site-specific and branch-site models to detect selection

    • Test whether selection signatures correlate with environmental factors

    • Compare selection patterns between Atlantic and Mediterranean populations

    • Determine if haplogroup distribution correlates with environmental conditions

  • Common Garden Experiments:

    • Measure respiratory efficiency in individuals with different COII variants

    • Subject to controlled environmental challenges

    • Quantify fitness differences associated with specific variants

    • Correlate performance with genetic variation

This integrated approach can reveal whether the differentiation observed between Atlantic and Mediterranean populations reflects adaptive evolution in the respiratory chain in response to different environmental conditions.

What are the major challenges in expressing mitochondrial membrane proteins like COII in recombinant systems?

Recombinant expression of P. lividus COII presents several challenges that researchers must address:

  • Membrane Protein Folding:

    • COII's hydrophobic domains often lead to misfolding in heterologous systems

    • Inclusion body formation in bacterial systems requires refolding

    • Solution: Use specialized strains with enhanced membrane protein folding capabilities

  • Cofactor Incorporation:

    • COII requires proper incorporation of copper ions for function

    • Challenge: Ensuring proper metallation during recombinant expression

    • Approach: Supplement growth media with bioavailable copper and include chaperones

  • Genetic Code Differences:

    • Mitochondrial genetic code differs from standard nuclear code

    • Problem: Potential mistranslation when expressing in standard systems

    • Strategy: Codon optimization accounting for genetic code differences

  • Protein-Protein Interactions:

    • Native function requires interaction with other respiratory complex components

    • Difficulty: Assessing activity in isolation from normal interaction partners

    • Method: Co-expression with other components or reconstitution approaches

  • Post-Translational Modifications:

    • Unknown P. lividus-specific modifications may be essential for function

    • Issue: Host systems may not reproduce required modifications

    • Approach: Compare mass spectrometric profiles of native and recombinant proteins

These challenges require systematic optimization strategies for successful expression of functional recombinant COII from P. lividus.

How can contradictory results from different analytical methods in COII studies be reconciled?

When faced with contradictory results in P. lividus COII studies, researchers should implement this systematic reconciliation framework:

  • Method-Specific Limitations Assessment:

    • Evaluate inherent biases in each analytical approach

    • Consider sensitivity to different aspects of molecular evolution

    • Determine statistical power given sample sizes and genetic diversity levels

  • Multi-Marker Comparison Strategy:

    • Compare COII results with other mitochondrial markers (COI, Cytb)

    • Assess concordance with nuclear markers

    • Identify patterns that appear consistently across marker types

  • Integrative Analysis Approach:

    • Combine data from multiple methods using hierarchical Bayesian frameworks

    • Weight results based on methodological robustness

    • Develop consensus models that accommodate apparently contradictory signals

  • Biological Context Interpretation:

    • Consider evolutionary processes that could generate conflicting signals:

      • Recent population expansion

      • Secondary contact between previously isolated lineages

      • Selection acting on specific gene regions

    • Evaluate whether apparent contradictions reflect biological complexity rather than methodological artifacts

  • Simulation-Based Validation:

    • Simulate data under different evolutionary scenarios

    • Process simulated data through the same analytical pipeline

    • Identify which scenarios produce patterns similar to observed contradictions

This approach has proven valuable in reconciling apparently contradictory results in P. lividus population studies, where different mitochondrial markers sometimes yield different estimates of population differentiation .

What emerging technologies might advance the study of recombinant P. lividus COII in the next decade?

Emerging technologies poised to transform recombinant P. lividus COII research include:

  • Cell-Free Expression Systems:

    • Advanced microfluidic platforms for membrane protein synthesis

    • Incorporation of native-like lipid nanodiscs during translation

    • High-throughput variant screening without cellular constraints

  • Cryo-Electron Microscopy Advances:

    • Single-particle analysis of COII within the respiratory complex

    • Visualization of conformational changes during electron transfer

    • Structural determination of population-specific variants to atomic resolution

  • Gene Editing in Model Organisms:

    • CRISPR-Cas9 modification of sea urchin mitochondrial genes

    • Creation of precise variants to test evolutionary hypotheses

    • Development of P. lividus as a tractable genetic model for mitochondrial biology

  • Computational Biology Applications:

    • Machine learning algorithms to predict functional consequences of variants

    • Molecular dynamics simulations of electron transfer mechanisms

    • Systems biology modeling of mitonuclear interactions

  • Single-Molecule Techniques:

    • Real-time observation of electron transfer events

    • Measurement of conformational dynamics during catalysis

    • Direct visualization of interactions with nuclear-encoded partners

These technological advances will enable unprecedented insights into the structure, function, and evolution of COII in P. lividus and its role in adaptation to changing marine environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.