Recombinant Paracentrotus lividus NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Paracentrotus lividus (Common sea urchin)
Target Names
ND3
Target Protein Sequence
MMTTTIFLFSITSAVAIIFALAAHILPTRNNDGEKNSPYECGFDPLNSARLPFSFRFFLV AILFLLFDLEIALLFPLPAASFLTHPTTLILISLAFMAILDAGLVFEWINPPLEWAE
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) and is believed to be part of the minimal assembly required for catalysis. Complex I plays a crucial role in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for this enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of ND3 in Paracentrotus lividus?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a core subunit of mitochondrial Complex I encoded in the P. lividus mitochondrial genome. The gene encoding ND3 is part of the 14 conserved catalytic core subunits that make up the minimal form of Complex I. Based on genomic analyses, P. lividus has a relatively well-preserved mitochondrial genome organization typical of echinoderms .

Recent de novo assembly of the P. lividus genome has identified more than 30,000 open reading frames (ORFs), including genes involved in oxidative metabolism and energy production . The mitochondrial genome, which includes the ND3 gene, has been sequenced as part of whole genome sequencing efforts using Illumina NextSeq 500 System in a 2 × 150 paired-end format .

What is the function of ND3 in mitochondrial Complex I?

ND3 is one of the seven core subunits in the membrane domain of Complex I that contains the proton pumps. Complex I couples the oxidation of NADH and reduction of ubiquinone to the translocation of four protons across the inner mitochondrial membrane, contributing to the proton motive force (Δp) used to power ATP synthesis .

ND3 specifically contributes to the formation of the membrane-embedded proton-pumping machinery. While the search results do not explicitly describe P. lividus ND3, we can infer from related systems that it plays a crucial role in the proton-pumping mechanism of Complex I, based on structural and functional studies in other organisms .

How conserved is the ND3 protein sequence across echinoderm species?

While the search results don't provide specific alignment data for ND3 across echinoderm species, we can infer high conservation based on the essential role of Complex I in cellular metabolism. The transcriptome assembly of P. lividus shows high gene completeness (97.4% and 95.6% in Eukaryota and Metazoa BUSCO databases, respectively) , suggesting that essential mitochondrial proteins like ND3 are well conserved.

Comparative analyses with other sea urchin species like Strongylocentrotus purpuratus, Hemicentrotus pulcherrimus, and Lytechinus variegatus would likely show high sequence conservation in functional domains of ND3, particularly in regions involved in proton pumping and interactions with other Complex I subunits.

What expression patterns does ND3 show in different P. lividus tissues and developmental stages?

The search results provide some insight into gene expression patterns in P. lividus gonads, which can be extrapolated to consider ND3 expression. The P. lividus transcriptome assembly described in the search results contains 53,865 transcripts, with differential gene expression analyses yielding 3371 and 3351 up-regulated genes in male and female gonad tissues, respectively .

For a comprehensive understanding of ND3 expression, researchers should consider:

  • Tissue-specific expression: While gonadal expression is documented, expression in other tissues would require specific analysis

  • Developmental regulation: Expression patterns may change throughout embryonic and larval development

  • Environmental influences: Factors such as temperature, pH, and food availability may affect ND3 expression levels

Research on related Complex I components suggests that expression of mitochondrial genes like ND3 may be coordinated with nuclear-encoded Complex I subunits, possibly through retrograde signaling mechanisms.

How can site-directed mutagenesis be used to investigate ND3 function in P. lividus?

Site-directed mutagenesis of ND3 can be performed using techniques adapted from other model systems. Drawing from the P. denitrificans model described in the search results, researchers working with P. lividus ND3 could:

  • Identify conserved residues of interest in ND3 using sequence alignment with homologous proteins

  • Design mutagenesis strategies targeting conserved charged residues that may be involved in proton pumping

  • Introduce mutations into recombinant expression systems

The search results mention a successful approach in P. denitrificans where "a point mutation in a conserved charge residue of the Nqo13 (ND4) subunit was created and confirmed to possess no catalytic activity" . A similar approach could be employed for ND3 in P. lividus to investigate the functional consequences of specific amino acid substitutions.

For successful mutagenesis studies, researchers should consider:

  • Conservation of target residues across species

  • Potential impact on protein stability versus function

  • Interpretation of results in the context of Complex I structure

What are the structural characteristics of P. lividus ND3 and how do they contribute to Complex I function?

While the search results don't provide explicit structural information about P. lividus ND3, we can infer its likely structural characteristics from related systems. Based on Complex I studies in other organisms described in the search results:

ND3 is a hydrophobic membrane protein with multiple transmembrane helices that contribute to the formation of proton translocation channels within Complex I. The protein likely interacts with other membrane domain subunits to form a coordinated proton-pumping apparatus that couples electron transfer to proton translocation.

Key structural features likely include:

  • Transmembrane helices forming part of the proton channel

  • Conserved charged residues involved in proton transfer

  • Interface regions that interact with other Complex I subunits

To determine the precise structure of P. lividus ND3, researchers would need to perform:

  • Homology modeling based on related structures

  • Protein expression and purification for structural studies

  • Potentially cryo-EM analysis of the entire Complex I

What are the optimal conditions for recombinant expression of P. lividus ND3?

Based on the search results and established protocols for membrane protein expression, researchers should consider the following approaches for recombinant expression of P. lividus ND3:

Expression Systems:

  • Bacterial systems (E. coli): May require fusion partners or specialized strains for membrane protein expression

  • Yeast systems (S. cerevisiae, P. pastoris): Better suited for eukaryotic membrane proteins

  • Insect cell systems: Provide eukaryotic processing with higher yields

Expression Optimization Table:

ParameterRecommended ApproachConsiderations
Expression vectorpET series with C-terminal His6-tagTag placement should minimize interference with protein function
Host strainC41(DE3) or C43(DE3)Strains designed for toxic membrane protein expression
Induction0.1-0.5 mM IPTG at 18-20°CLower temperatures reduce inclusion body formation
Media supplements1% glucose pre-inductionRepresses basal expression that could be toxic
5-10% glycerol in bufferStabilizes membrane proteins

The search results describe a successful approach for Complex I purification in P. denitrificans using "an affinity purification tag onto the C-terminus of the Nqo5 (NDUFS3) subunit. The affinity tag contained six histidine residues attached to the Nqo5 subunit by six alanine linker residues" . A similar strategy could be adapted for P. lividus ND3 expression and purification.

What purification strategies are most effective for recombinant P. lividus ND3?

Purification of recombinant ND3 requires specialized approaches due to its hydrophobic nature as a membrane protein:

Recommended Purification Protocol:

  • Membrane Preparation:

    • Harvest cells and disrupt by sonication or pressure homogenization

    • Separate membranes by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization:

    • Use mild detergents (DDM, LMNG, or digitonin at 1-2%)

    • Include protease inhibitors and stabilizing agents (glycerol, salt)

  • Affinity Purification:

    • Immobilized metal affinity chromatography (IMAC) using the His6-tag

    • Wash with low imidazole (20-40 mM) to reduce non-specific binding

    • Elute with 250-300 mM imidazole

  • Secondary Purification:

    • Size exclusion chromatography to separate aggregates

    • Ion exchange chromatography for additional purity

The search results indicate that complex mitochondrial proteins can be effectively purified using affinity tags, as demonstrated in the P. denitrificans system .

How can researchers assess the functional activity of recombinant P. lividus ND3?

Activity Assays:

  • Reconstitution Studies:

    • Incorporation into liposomes with other Complex I subunits

    • Measurement of proton pumping using pH-sensitive fluorescent dyes

  • Spectroscopic Analysis:

    • EPR spectroscopy to analyze iron-sulfur cluster environment

    • Similar to the approach described for P. denitrificans where "EPR spectrum recorded at 16 K, using an equal stoichiometry of the four observed FeS clusters" was used

  • NADH:Ubiquinone Oxidoreductase Activity:

    • Measure NADH oxidation rates spectrophotometrically (340 nm)

    • Assess inhibitor sensitivity (rotenone, piericidin)

Expected Activity Parameters:

AssayTypical ValuesIndicators of Proper Folding
NADH oxidation1-2 μmol/min/mgLinear reaction rates
Inhibitor sensitivity90-95% inhibition by 5 μM rotenoneSpecific binding sites intact
Proton pumping4 H+ per NADH oxidizedFunctional proton channels

The search results mention that preparations of Complex I from P. denitrificans were "highly active for NADH:ubiquinone oxidoreduction" , providing a benchmark for expected activity levels.

What are common challenges in expressing recombinant ND3 and how can they be addressed?

Recombinant expression of mitochondrial membrane proteins like ND3 presents several challenges:

Challenge 1: Toxicity to host cells

  • Solution: Use controlled expression systems with tight regulation (T7-lac or tet promoters)

  • Approach: Employ specialized host strains designed for toxic protein expression (C41/C43)

Challenge 2: Improper membrane insertion

  • Solution: Include appropriate signal sequences or fusion partners

  • Approach: Co-express with chaperones that assist membrane protein folding

Challenge 3: Protein aggregation

  • Solution: Optimize expression temperature (typically lower at 16-20°C)

  • Approach: Use solubility-enhancing fusion partners (MBP, SUMO)

The search results indicate that heterozygosity and high repeat content can complicate genomic work with P. lividus, with researchers noting "high levels of heterozygosity as well as repeat content and several difficulties in the building of the genome references" . These genetic characteristics may also affect recombinant expression efforts.

How can researchers differentiate between properly folded and misfolded recombinant ND3?

Distinguishing properly folded ND3 from aggregated or misfolded protein is critical for meaningful functional studies:

Assessment Methods:

  • Size Exclusion Chromatography:

    • Properly folded membrane proteins typically show defined elution profiles

    • Aggregates elute in the void volume

  • Circular Dichroism (CD) Spectroscopy:

    • Secondary structure content analysis

    • Expected high alpha-helical content for properly folded ND3

  • Limited Proteolysis:

    • Correctly folded proteins show discrete, reproducible digestion patterns

    • Misfolded proteins typically exhibit rapid, non-specific degradation

  • Thermal Stability Assays:

    • Differential scanning fluorimetry with appropriate dyes

    • Properly folded proteins show cooperative unfolding transitions

The search results describe quality control methods for transcriptome assembly of P. lividus that could conceptually apply to protein quality: "After quality filtering control, clean reads were first concatenated and then assembled" . Similarly, protein preparations require quality control to ensure structural integrity.

How can CRISPR-Cas9 genome editing be used to study ND3 function in P. lividus?

The recently sequenced genome of P. lividus provides opportunities for CRISPR-Cas9 genome editing to study ND3 function:

Genome Editing Approach:

  • Design considerations:

    • Target mitochondrial ND3 gene with specific gRNAs

    • Include donor templates for precise mutations or epitope tagging

  • Delivery methods:

    • Microinjection into fertilized P. lividus eggs

    • Optimization of Cas9 and gRNA concentrations

  • Validation strategies:

    • PCR and sequencing of target regions

    • Western blotting with specific antibodies for tagged versions

The search results indicate that P. lividus has been developed as a model system: "The genome presented here will provide a paradigm for studying novel features in model animals, such as molecular pathways underlying important physiological processes" . This genomic resource facilitates the design of genome editing approaches.

What are the implications of ND3 mutations for P. lividus mitochondrial function and ecology?

Understanding ND3 mutations can provide insights into both basic biology and ecological adaptations:

Biological Implications:

  • Bioenergetic consequences:

    • Altered ATP production affecting energy-demanding processes

    • Potential compensatory mechanisms in metabolism

  • Oxidative stress management:

    • Changes in ROS production with downstream effects on cellular aging

    • Activation of antioxidant defense systems

Ecological Relevance:

Mutations in ND3 could affect P. lividus fitness in its natural habitat. The search results indicate that P. lividus is subject to predation pressure: "Fish predation and the structure of the sea urchin Paracentrotus lividus" . Energy limitations from mitochondrial dysfunction could affect:

  • Predator avoidance capabilities

  • Reproductive output

  • Ability to withstand environmental stressors

The search results also mention that P. lividus is "economically important" and "a key grazer" in marine ecosystems, suggesting that mitochondrial function has broader ecological implications.

How can structural biology approaches advance our understanding of P. lividus ND3?

Structural biology can provide critical insights into ND3 function within Complex I:

Recommended Approaches:

  • Cryo-electron microscopy:

    • Isolation of intact Complex I containing ND3

    • Single-particle analysis for structural determination

    • Resolution of 2.5-3.5 Å achievable for membrane complexes

  • Computational modeling:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to study proton translocation

  • Cross-linking mass spectrometry:

    • Identification of interaction partners within Complex I

    • Mapping of subunit interfaces

The search results describe EPR analysis of Complex I from a related organism: "This 'signature' spectrum for Pd-CI shows remarkable similarity to that observed for mitochondrial complex I from Y. lipolytica" . Similar comparative approaches could be valuable for structural studies of P. lividus Complex I components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.