Recombinant Paracentrotus lividus NADH-ubiquinone oxidoreductase chain 4L (ND4L)
Shipped with Ice Packs 
In Stock 
Description
Key Genomic Features of P. lividus ND4L
Production Parameters
This recombinant protein retains enzymatic activity, with EC number 1.6.5.3 .
Functional and Evolutionary Insights
-
Role in Complex I: ND4L contributes to proton translocation across the mitochondrial membrane during NADH oxidation .
-
Evolutionary divergence: The atypical gene order in P. lividus mtDNA provides insights into mitochondrial genome plasticity. Comparative studies show distinct transcription termination mechanisms compared to Drosophila .
Comparative Mitochondrial Gene Organization
| Species | ND4L Adjacency | Ribosomal RNA Separation |
|---|---|---|
| P. lividus | tRNAArg-CoII | 12S and 16S rRNA separated by ND1/ND2 |
| Vertebrates | ND4L-ND4 | 12S and 16S rRNA contiguous |
Research Applications
-
ELISA and antibody development: Commercial kits (e.g., Anagnostics CSB-CF015080ERM-GB) utilize recombinant ND4L for quantitative assays .
-
Mitochondrial transcription studies: Used to investigate transcription termination factors like mtDBP in sea urchins .
-
Evolutionary biology: Serves as a model for studying gene rearrangements in deuterostome mitochondria .
Product Specs
Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, kindly indicate your preference when placing the order. We will accommodate your request to the best of our ability.
Please note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, kindly indicate your preference when placing the order. We will accommodate your request to the best of our ability.
Lead Time
The delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance. Additional fees may apply.
Note: All our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please communicate your requirements, and we will prioritize developing the specified tag.
Synonyms
ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-97
Protein Length
full length protein
Species
Paracentrotus lividus (Common sea urchin)
Target Names
ND4L
Target Protein Sequence
MALLIIILSMFYLGLMGILLNRLHFLSILLCLELLLISLFIGIATWNTSNSIPQNTTFNL
LLLTLSACEASIGLSLMVALSRTHSSDLVASLSLLQY
Uniprot No.
Target Background
Function
The NADH-ubiquinone oxidoreductase chain 4L (ND4L) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This subunit is believed to be part of the minimal assembly required for catalysis. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
