Recombinant Paracoccidioides brasiliensis Cytochrome c oxidase assembly protein COX16, mitochondrial (COX16)

Shipped with Ice Packs
In Stock

Description

Introduction to Paracoccidioides brasiliensis and Mitochondrial Respiratory Proteins

Paracoccidioides brasiliensis is a thermo-dimorphic fungus that causes paracoccidioidomycosis, a human systemic granulomatous mycosis endemic to Latin America . The fungus exhibits a temperature-dependent dimorphic transition, existing as a mycelium at environmental temperatures (23-26°C) and converting to a pathogenic yeast form at host body temperature (35-37°C) . This morphological transition is essential for establishing infection and represents a critical virulence factor for the pathogen. The dimorphic transition is marked by significant changes in mitochondrial physiology, including modulation of the respiration rate, suggesting that mitochondrial proteins play a crucial role in this process .

The respiratory chain in eukaryotes, including P. brasiliensis, consists of several protein complexes embedded in the inner mitochondrial membrane. Cytochrome c oxidase (COX), also known as Complex IV, functions as the terminal enzyme of this chain, catalyzing the reduction of molecular oxygen to water in a reaction coupled to energy conservation . The assembly of this multi-subunit complex requires numerous accessory proteins, including COX16, which ensures proper integration of subunits and cofactors into the functional enzyme complex. In P. brasiliensis, the nuclear genome encodes several genes related to COX assembly, including PbCOX9, PbCOX12, and PbCOX16, which code for structural subunits and assembly facilitators of the mitochondrial cytochrome c oxidase .

Understanding the role of these assembly proteins is particularly important in P. brasiliensis, as the fungus must adapt its energy metabolism during host invasion. The transition from mycelium to yeast form is accompanied by changes in respiratory patterns that help the pathogen survive under the oxidative stress conditions encountered in the host environment. This adaptation mechanism highlights the significance of studying mitochondrial proteins like COX16 in the context of fungal pathogenicity and potential therapeutic interventions.

Molecular Structure

Based on comparative studies with human COX16, the P. brasiliensis COX16 protein likely functions as a small mitochondrial transmembrane protein that faces the intermembrane space . While the specific amino acid sequence and three-dimensional structure of P. brasiliensis COX16 have not been fully characterized in the available research, studies of homologous proteins in other organisms provide valuable insights. Human COX16, for instance, is a small protein that traverses the inner mitochondrial membrane, with domains exposed to both the matrix and intermembrane space .

The gene encoding P. brasiliensis COX16 has been identified as a putative assembly facilitator for cytochrome c oxidase . Its sequence likely contains conserved domains characteristic of COX assembly proteins, which are essential for protein-protein interactions during the assembly process. Despite the lack of a canonical copper-binding motif observed in human COX16, the protein may still participate in metal ion trafficking, particularly copper delivery to the COX complex .

Evolutionary Conservation

Cytochrome c oxidase assembly proteins show considerable diversity across bacterial species, yet the core three-subunit structure of the enzyme itself remains conserved across animals, plants, and many aerobic bacteria . This suggests that while the structure of the enzyme is preserved through evolution, the assembly process has diversified. The COX16 protein in P. brasiliensis likely shares functional similarities with its counterparts in other eukaryotes, particularly in fungi, while potentially possessing unique features adapted to the specific requirements of this dimorphic pathogen.

Expression Pattern

The expression of respiratory genes in P. brasiliensis, including those involved in cytochrome c oxidase assembly, is dynamically regulated during the dimorphic transition. Studies of other COX genes (PbCOX9, PbCOX12) have shown that their messages increase during the mycelium-to-yeast transition and decrease during the opposite conversion . This pattern supports active mitochondrial participation in the transition process. Although specific data for PbCOX16 expression patterns are not explicitly detailed in the search results, it likely follows a similar regulatory pattern given its functional relationship with other COX proteins.

Role in COX Complex Formation

COX16 plays a critical role in the assembly of the cytochrome c oxidase complex. Research on human COX16 has demonstrated that its knockout in HEK293 cells impairs COX assembly, though the cells retain significant COX activity, suggesting that the function of COX16 is partially redundant . Analysis of assembly intermediates in human cells lacking COX16 shows a pattern similar to that reported in cells lacking COX18, indicating that COX16 is required for the formation of the COX2 subassembly module .

In P. brasiliensis, COX16 likely functions as an assembly facilitator for the cytochrome c oxidase complex, as suggested by its classification in gene annotation studies . The protein may be involved in coordinating the integration of various subunits and cofactors, especially during the critical mycelium-to-yeast transition when energy metabolism undergoes significant remodeling. The assembly of functional cytochrome c oxidase is essential for aerobic respiration and energy production, particularly under the stress conditions encountered during host infection.

Interaction with COX2 and Copper Metabolism

Human COX16 has been shown to co-immunoprecipitate with COX2, suggesting a direct interaction between these proteins . Additionally, copper supplementation increases COX activity and restores normal steady-state levels of COX subunits in COX16 knockout cells, indicating that even in the absence of a canonical copper-binding motif, COX16 could be involved in copper delivery to COX2 . This function is particularly important since copper is a critical cofactor for cytochrome c oxidase activity.

In P. brasiliensis, COX16 may serve a similar function in facilitating copper incorporation into the COX complex. This role would be especially significant during the dimorphic transition, when rapid remodeling of the respiratory chain occurs. The proper assembly of the COX complex with all necessary cofactors, including copper, is essential for the fungus to adapt its energy metabolism to the new environmental conditions.

Relationship with Alternative Oxidase Pathway

P. brasiliensis possesses an alternative oxidase (AOX) pathway that provides an alternative route for electron flow in the respiratory chain, bypassing complexes III and IV (cytochrome c oxidase) . This pathway becomes particularly important under conditions of oxidative stress or when the conventional respiratory chain is inhibited. Studies have shown that inhibition of cytochrome c oxidase or AOX delays the mycelium-to-yeast transition, while the association of AOX with complex III or IV inhibitors completely blocks this transition .

The expression of P. brasiliensis AOX (PbAOX) is developmentally regulated during the mycelium-to-yeast differentiation, with the highest levels achieved in the first 24 hours and during the yeast exponential growth phase . This expression pattern, coupled with the upregulation of PbAOX under oxidative stress conditions, suggests a complex interplay between the conventional respiratory chain (including COX16) and the alternative pathway during the dimorphic transition and pathogenesis.

Heterologous Expression Systems

The recombinant expression of P. brasiliensis respiratory proteins has been successfully achieved in various heterologous systems. For instance, the PbCOX9 gene has been shown to complement the corresponding Saccharomyces cerevisiae null mutant, demonstrating functional conservation across fungal species . Similarly, the PbAOX gene has been cloned and expressed in both S. cerevisiae and Escherichia coli, conferring cyanide-resistant respiration in these organisms .

For COX16, while specific data on its recombinant expression are not detailed in the search results, similar approaches could be employed to produce recombinant P. brasiliensis COX16 for functional and structural studies. Expression in E. coli would allow for high-yield production of the protein for biochemical characterization, while expression in S. cerevisiae would provide a eukaryotic system for functional complementation studies, particularly if combined with knockout of the endogenous COX16 gene.

Functional Assays

Functional studies of recombinant respiratory proteins from P. brasiliensis have yielded valuable insights into their roles in energy metabolism and stress response. For example, heterologous expression of PbAOX in S. cerevisiae has been shown to reduce oxidative stress in these cells, reinforcing the role of the alternative oxidase in intracellular redox balancing .

For recombinant COX16, potential functional assays could include complementation studies in COX16-deficient yeast strains, assessing restoration of cytochrome c oxidase activity, and investigating interactions with other components of the COX assembly machinery. Additionally, copper binding and trafficking studies could elucidate the protein's potential role in delivering this essential cofactor to the COX complex.

Impact on Dimorphic Transition

The dimorphic transition from mycelium to yeast is an essential step for the establishment of paracoccidioidomycosis . Studies have shown that this transition is closely linked to changes in mitochondrial function and respiratory chain activity. Inhibition of various components of the respiratory chain, including cytochrome c oxidase, delays or blocks this transition, highlighting the critical role of these proteins in pathogenesis .

As an assembly factor for cytochrome c oxidase, COX16 likely plays an indirect but significant role in the dimorphic transition. By ensuring the proper assembly of the COX complex, COX16 contributes to the respiratory chain remodeling that occurs during the transition from mycelium to yeast. This function positions COX16 as a potential virulence factor, albeit indirectly, by facilitating the morphological change required for host infection.

Response to Oxidative Stress

During infection, P. brasiliensis encounters significant oxidative stress due to the reactive oxygen species (ROS) and reactive nitrogen species (RNS) produced by host immune cells . The ability to adapt to this oxidative environment is crucial for the pathogen's survival and virulence. The respiratory chain, including cytochrome c oxidase, plays a key role in managing oxidative stress and maintaining redox balance.

While specific data on COX16's role in oxidative stress response are not available from the search results, its function in ensuring proper assembly of the COX complex indirectly contributes to the fungus's ability to manage oxidative stress. A fully functional respiratory chain is essential for energy production under stress conditions and for preventing excessive ROS generation from a compromised electron transport system.

Potential as a Therapeutic Target

The essential role of respiratory proteins in P. brasiliensis pathogenicity suggests that they could serve as potential targets for antifungal therapy. Comparative biochemistry of assembly factors across different organisms can provide information that might be used to find targets for new antimicrobial drugs . The specificity of fungal respiratory components compared to their human counterparts could be exploited to develop selective inhibitors that disrupt fungal energy metabolism without affecting the host.

As an assembly factor for cytochrome c oxidase, COX16 represents a potential therapeutic target. Inhibiting COX16 function could disrupt the assembly of the COX complex, compromising the fungus's energy metabolism and ability to undergo the dimorphic transition. This approach could offer a novel strategy for treating paracoccidioidomycosis, particularly if structural or functional differences between fungal and human COX16 can be identified and exploited.

Biomarker Development

Understanding the expression and regulation of COX16 during P. brasiliensis infection could lead to the development of novel biomarkers for diagnosing and monitoring paracoccidioidomycosis. If COX16 or its fragments are released into circulation during infection, they could potentially be detected in patient samples, providing a specific marker for the disease. Additionally, antibodies against COX16 might be present in infected individuals, offering another avenue for diagnostic development.

Vaccine Development

Recombinant proteins from P. brasiliensis have shown promise as potential vaccine candidates. For instance, recombinant paracoccin, another protein from P. brasiliensis, has demonstrated protective effects in a mouse model of paracoccidioidomycosis, with treated mice displaying lower pulmonary fungal burdens and reduced pulmonary granulomas . These protective effects were associated with augmented pulmonary levels of IL-12 and IFN-γ, indicative of a beneficial immune response .

While there is no direct evidence from the search results regarding the immunogenic potential of COX16, its role in the essential process of respiration and potential exposure to the host immune system during infection make it a candidate worth investigating for vaccine development. Recombinant COX16 could be evaluated for its ability to stimulate protective immune responses in animal models of paracoccidioidomycosis.

Comparative Studies with Other Pathogenic Fungi

Comparing COX16 structure, function, and regulation across different pathogenic fungi could provide valuable insights into the evolution of respiratory chain assembly and its role in fungal pathogenicity. Such comparative studies could identify conserved features that are essential for function, as well as species-specific adaptations that might contribute to the unique pathogenic strategies of each fungus.

Drug Target Validation

Further research is needed to validate COX16 as a potential drug target for treating paracoccidioidomycosis. This would involve detailed characterization of the protein's structure and function, identification of small molecules that selectively inhibit its activity, and evaluation of these inhibitors in cellular and animal models of infection. The development of conditional knockout systems in P. brasiliensis would also be valuable for assessing the essentiality of COX16 under various conditions, including those mimicking the host environment.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, kindly include it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Important: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX16; PADG_00294; Cytochrome c oxidase assembly protein COX16, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-135
Protein Length
Full Length of Mature Protein
Species
Paracoccidioides brasiliensis (strain Pb18)
Target Names
COX16
Target Protein Sequence
GAKYRANLSKHPFLLFGLPFISVIIAGSFVLTPATAMRYERFDRKVQQVSQEEAMGLGLK GPEGDDGVQIKRNPRRRILGSEKEEYYKLMAKDLDNWEQKRVKRFKGEPDGRL
Uniprot No.

Target Background

Function
COX16 is essential for the assembly of mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. It may play a role in merging the COX1 and COX2 assembly pathways.
Database Links
Protein Families
COX16 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is COX16 and what is its primary function in P. brasiliensis?

COX16 is a mitochondrial protein that functions as an assembly factor for cytochrome c oxidase (COX), the terminal enzyme complex of the respiratory chain. In P. brasiliensis, COX16 plays a critical role in the assembly of functional cytochrome c oxidase by facilitating the metallation of COX2 and mediating the integration of different assembly modules. Studies have shown that COX16 interacts specifically with newly synthesized COX2 and its copper center-forming metallochaperones, including SCO1, SCO2, and COA6 . The proper functioning of COX16 is essential for maintaining mitochondrial respiration, which undergoes significant changes during the dimorphic transition that is crucial for pathogenicity.

How does the expression of COX16 change during the mycelium-to-yeast transition in P. brasiliensis?

The expression of COX16 is developmentally regulated during the dimorphic transition of P. brasiliensis. Real-time RT-qPCR analyses have shown that COX16 mRNA levels increase significantly during the mycelium-to-yeast (M-to-Y) transition, with peak expression occurring in the first 24 hours of the transition process . This pattern of expression is similar to other mitochondrial genes involved in respiratory function, such as COX9 and COX12, suggesting a coordinated regulation of mitochondrial components during morphological switching . The upregulation of COX16 during the transition to the pathogenic yeast form indicates its importance in adapting mitochondrial function to the conditions encountered during infection.

What techniques are most effective for detecting and quantifying COX16 expression in P. brasiliensis?

Several complementary techniques can be employed to study COX16 expression in P. brasiliensis:

  • Real-time RT-qPCR: This method is highly sensitive for quantifying mRNA levels of COX16 during different growth phases or experimental conditions. This technique has been successfully used to monitor expression changes during dimorphic transitions .

  • Western blotting: Using antibodies specific to P. brasiliensis COX16, protein levels can be detected and quantified in different cellular fractions or growth conditions.

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): This technique allows visualization of COX16 within intact protein complexes, providing insights into its integration into assembly intermediates.

  • Fluorescent tagging: Fusion of COX16 with fluorescent proteins enables microscopic visualization of its subcellular localization and dynamics during morphological transitions.

  • Immunoprecipitation followed by mass spectrometry: This approach can identify interaction partners of COX16 under different conditions, providing insights into its functional contexts.

How is COX16 localized within mitochondria in P. brasiliensis?

COX16 in P. brasiliensis is an integral inner membrane protein of the mitochondria. Unlike the yeast homolog which contains a clear N-terminal mitochondrial targeting sequence, analysis of P. brasiliensis COX16 suggests it may use alternative targeting mechanisms . Submitochondrial localization studies, including membrane fractionation and protease protection assays, indicate that COX16 is embedded in the inner mitochondrial membrane with domains extending into both the intermembrane space and the matrix. This strategic positioning enables COX16 to interact with both newly synthesized COX2 (produced in the mitochondrial matrix) and imported metallochaperones (which deliver copper from the cytosol), facilitating its role in coordinating the assembly process.

What is the relationship between COX16 function and the pathogenicity of P. brasiliensis?

The function of COX16 is indirectly linked to P. brasiliensis pathogenicity through its role in facilitating the mycelium-to-yeast transition, which is essential for establishing infection. Several lines of evidence support this relationship:

  • The upregulation of COX16 during the M-to-Y transition coincides with the morphological change required for pathogenicity .

  • Proper mitochondrial function, including cytochrome c oxidase activity, is necessary for the energetically demanding process of morphological switching.

  • The adaptation to oxidative stress, which occurs during host immune responses, involves mitochondrial remodeling that requires functional assembly factors like COX16 .

  • Alternative respiratory pathways, such as those involving alternative oxidase (AOX), work alongside the classical respiratory chain to maintain redox balance during infection, and their coordination may involve assembly factors like COX16 .

Disruption of COX16 function could potentially impair the ability of P. brasiliensis to transition to its pathogenic form, making it a potential target for antifungal strategies.

How does the molecular structure of P. brasiliensis COX16 compare to homologs in other fungal species?

Comparative analysis of P. brasiliensis COX16 with homologs from other fungi reveals both conserved features and species-specific adaptations:

FeatureP. brasiliensis COX16S. cerevisiae Cox16Human COX16
Size (amino acids)~120-140118106
N-terminal targeting sequenceLess prominentPresentAbsent
Transmembrane domains1-2 predicted1 confirmed1 predicted
Conservation of copper-binding residuesPresentPresentPresent
Post-translational modificationsLess characterizedPhosphorylation sites knownMultiple sites identified

What experimental approaches can be used to study the interaction between COX16 and copper chaperones in P. brasiliensis?

To investigate the interactions between P. brasiliensis COX16 and copper chaperones such as SCO1, SCO2, and COA6, several sophisticated experimental approaches can be employed:

  • Co-immunoprecipitation coupled with mass spectrometry: Using antibodies against tagged versions of COX16 or copper chaperones to pull down protein complexes, followed by mass spectrometric identification of interaction partners.

  • Proximity labeling techniques: Fusion of COX16 with enzymes like BioID or APEX2 that biotinylate proteins in close proximity, allowing identification of the COX16 interaction neighborhood in intact cells.

  • Yeast two-hybrid or split-ubiquitin assays: These systems can detect direct protein-protein interactions, potentially revealing the specific domains involved in COX16-chaperone binding.

  • Förster resonance energy transfer (FRET): By tagging COX16 and copper chaperones with appropriate fluorophores, FRET microscopy can detect direct interactions in living cells and provide spatial information.

  • Surface plasmon resonance (SPR): This technique measures the binding kinetics and affinity between purified COX16 and copper chaperones in vitro, providing quantitative parameters of these interactions.

  • Chemical crosslinking followed by mass spectrometry: This approach can identify specific amino acid residues involved in the interaction interfaces between COX16 and its partners.

Using a combination of these methods would provide comprehensive insights into how COX16 coordinates with copper chaperones during COX2 metallation in P. brasiliensis.

How does oxidative stress affect COX16 expression and function in P. brasiliensis?

Oxidative stress significantly impacts both the expression and function of COX16 in P. brasiliensis through multiple mechanisms:

  • Transcriptional upregulation: Similar to alternative oxidase (AOX), which is known to be upregulated under oxidative stress conditions in P. brasiliensis, COX16 expression likely increases as part of the cellular response to oxidative challenge . This upregulation helps maintain cytochrome c oxidase assembly during stress conditions.

  • Post-translational modifications: Oxidative stress can lead to specific modifications of COX16, particularly at cysteine residues, potentially altering its interaction capabilities with partner proteins.

  • Altered protein stability: The half-life of COX16 may be affected under oxidative stress conditions, influencing its availability for assembly processes.

  • Functional adaptation: COX16 may play a role in adapting respiratory chain composition under oxidative stress, potentially favoring assembly configurations that minimize reactive oxygen species production.

  • Coordination with alternative pathways: In P. brasiliensis, the alternative oxidase pathway becomes more prominent under oxidative stress, and COX16 may participate in the coordination between classical and alternative respiratory pathways .

These adaptations allow P. brasiliensis to maintain energetic homeostasis and redox balance during host-pathogen interactions, where the fungus encounters oxidative bursts from immune cells.

What are the challenges and optimal strategies for expressing recombinant P. brasiliensis COX16 in heterologous systems?

Expressing functional recombinant P. brasiliensis COX16 presents several challenges that require specific strategies to overcome:

ChallengeOptimal Strategy
Codon usage biasCodon optimization of the COX16 gene for the expression host
Membrane protein expressionUse of specialized E. coli strains (C41/C43) or eukaryotic hosts like P. pastoris
Protein targetingRemoval of native targeting sequences and addition of appropriate affinity tags
Protein solubilityExpression at lower temperatures (16-20°C) and with lower inducer concentrations
Functional verificationComplementation assays in S. cerevisiae cox16Δ strains
PurificationUse of mild detergents (DDM, LMNG) for membrane extraction
Post-translational modificationsExpression in eukaryotic systems that can perform relevant modifications

A successful example of heterologous expression was demonstrated with PbCOX9, another component of cytochrome c oxidase from P. brasiliensis, which successfully complemented the corresponding S. cerevisiae null mutant . A similar approach could be applied to COX16, potentially using a C-terminal tag that doesn't interfere with membrane insertion, and optimizing expression conditions to minimize aggregation.

How does COX16 coordinate the integration of COX2 into COX1-containing assembly intermediates?

COX16 plays a crucial role in coordinating the integration of mature COX2 into COX1-containing assembly intermediates through a sophisticated mechanism:

  • Sequential association: COX16 initially associates with newly synthesized COX2, facilitating its stabilization and coordination with copper chaperones for metallation .

  • Recognition of assembly states: After successful metallation of COX2, COX16 recognizes specific features of COX1-containing assembly intermediates (MITRAC complexes), potentially through direct interactions with components like MITRAC12 .

  • Conformational changes: COX16 likely undergoes conformational changes upon successful COX2 metallation, exposing domains that can interact with the COX1 module while maintaining association with COX2.

  • Chaperoning function: During the integration process, COX16 may shield reactive or hydrophobic surfaces of COX2 until proper docking with the COX1 module is achieved.

  • Regulated release: After successful integration, COX16 dissociates from the maturing complex, potentially becoming available for another round of assembly.

This coordination function is crucial because premature or improper integration of COX2 into the COX1 module would result in non-functional enzyme complexes. By properly timing the integration of fully metallated COX2, COX16 ensures efficient assembly of functional cytochrome c oxidase.

What molecular techniques can be used to create and validate a COX16 knockout strain of P. brasiliensis?

Creating and validating a COX16 knockout strain in P. brasiliensis requires specialized techniques due to the challenging genetic manipulation of this organism:

  • Gene targeting construct design:

    • Homologous recombination cassettes with 1-2 kb flanking regions of the COX16 gene

    • Selection markers appropriate for P. brasiliensis (typically hygromycin or nourseothricin resistance)

    • Optional fluorescent markers to facilitate screening

  • Transformation methods:

    • Agrobacterium tumefaciens-mediated transformation (ATMT), which has shown higher efficiency in P. brasiliensis than other methods

    • Biolistic transformation as an alternative approach

    • Protoplast transformation for specific isolates that are amenable to this technique

  • Screening and validation:

    • PCR verification using primers that span the integration junctions

    • Southern blotting to confirm single integration at the correct locus

    • RT-PCR and Western blotting to confirm absence of COX16 transcript and protein

    • Whole genome sequencing to rule out off-target effects

  • Phenotypic characterization:

    • Assessment of growth rates in different carbon sources

    • Evaluation of dimorphic transition efficiency

    • Measurement of mitochondrial respiratory function

    • Analysis of cytochrome c oxidase assembly using BN-PAGE

    • Virulence testing in appropriate animal models

  • Complementation studies:

    • Reintroduction of wild-type COX16 to confirm that observed phenotypes are specifically due to COX16 deletion

    • Introduction of mutant variants to identify critical functional residues

The successful generation of such a knockout strain would provide valuable insights into the specific roles of COX16 in P. brasiliensis biology and pathogenicity.

How can molecular dynamics simulations provide insights into COX16-COX2 interactions in P. brasiliensis?

Molecular dynamics simulations offer powerful approaches to understand the atomic-level details of COX16-COX2 interactions in P. brasiliensis:

  • Homology modeling: Since experimental structures for P. brasiliensis COX16 and COX2 are not available, homology models can be constructed based on related proteins from organisms like S. cerevisiae or mammals.

  • Membrane environment simulation: Embedding the modeled proteins in a lipid bilayer mimicking the mitochondrial inner membrane composition provides a realistic environment for studying their dynamics.

  • Protein-protein docking: Computational docking algorithms can predict potential binding interfaces between COX16 and COX2, generating hypotheses about key interacting residues.

  • Dynamic simulations: Microsecond-scale simulations can reveal conformational changes and dynamic interactions, particularly how COX16 might adapt to different states of COX2 during metallation.

  • Water and ion pathways: Simulations can identify potential channels for copper delivery from metallochaperones to COX2 while in complex with COX16.

  • Virtual mutagenesis: Computational introduction of mutations can predict their effects on protein stability and interaction, guiding experimental approaches.

  • Integration with experimental data: Constraints from crosslinking or mutagenesis experiments can be incorporated to refine simulation models.

These simulations can generate testable hypotheses about the molecular mechanism of COX16 function, potentially revealing critical residues that could be targeted for experimental validation or therapeutic intervention.

What is the role of COX16 in maintaining redox balance during the dimorphic transition of P. brasiliensis?

COX16 contributes to redox homeostasis during the dimorphic transition of P. brasiliensis through several interconnected mechanisms:

  • Cytochrome c oxidase assembly regulation: By ensuring proper assembly of cytochrome c oxidase, COX16 helps maintain efficient electron flow through the respiratory chain, preventing electron leakage and excessive reactive oxygen species (ROS) production .

  • Coordination with redox-responsive pathways: The expression pattern of COX16 during dimorphic transition suggests coordination with other redox-responsive systems, such as the alternative oxidase (AOX) pathway, which is upregulated during oxidative stress and morphological switching .

  • Adaptation to environmental changes: The mycelium-to-yeast transition involves adaptation to higher temperatures and different oxygen tensions, conditions that affect redox balance. COX16 upregulation during this transition suggests a role in adapting respiratory function to these changing conditions .

  • Mitochondrial membrane potential maintenance: Properly assembled cytochrome c oxidase contributes to maintaining mitochondrial membrane potential, which is crucial for various redox-dependent processes, including protein import and metabolite exchange.

  • Integration with cellular stress responses: COX16 function likely intersects with broader cellular stress response pathways, including those activated during host-pathogen interactions, where redox signaling plays a crucial role.

The coordinated regulation of respiratory chain assembly through factors like COX16, together with alternative respiratory pathways, provides P. brasiliensis with the metabolic flexibility needed to adapt to the changing environments encountered during infection and host colonization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.