Recombinant Paracoccidioides brasiliensis Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIC60; PADG_03039; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-641
Protein Length
Full Length of Mature Protein
Species
Paracoccidioides brasiliensis (strain Pb18)
Target Names
MIC60
Target Protein Sequence
PASPSTGSTLKPETVLVAPVSPLRQGQSSPGSAAPAPEPAAAPPPSPPPPPPAPKTGRLR KFLLYLFLTTGLAYAGGVWYSLRSDNFYDFFTEYAPYGENAVIYLEERDFRNRFPNATKK NNRRAVAPRDEGAQVTIPGGSGLSWKVAEEQQEGSDISKKGPHMSAVDNNKATKDTKTVE KTKGGVTSKSPAQKEEAVKTKPAPEGVKTQPAKVAETPREPAIPAITTIDHLVLNTEDEP VVQDLVKVFNDIITVISADAPSSFSGPVAKAKEELEKIGKRILALKSDAQASAQKEINDA HASFDKSAANLIRHIDEMRAEDATKFREEFEAERERIAQSYQEKINTELQRAHEVAEQRL RNELVEQAIELNRKFLSDVKNLVEHERESRLSKLAELVSSVAELERLTAGWSNVIDINLK TQQLQVAVDAVRTTLENSNVPRPFIRELAAVKELASNDEVVSAAIDSISPVAYQRGIPSS AHLVDRFRRVATEVRKASLLPENAGITSHAASFVLNKVMLKKHGSPAGNDVESTLTRAEN FLEEGNLDEAAREMNSLKGWAKLLSKDWLADVRRVLEVKQALEVIETEARLRCLQVE
Uniprot No.

Target Background

Function
A component of the mitochondrial inner membrane complex, MICOS, which plays a critical role in maintaining crista junctions, inner membrane architecture, and the formation of contact sites with the outer membrane. FCJ1 contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane. It also facilitates protein import through the mitochondrial intermembrane space assembly (MIA) pathway.
Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is FCJ1 and what role does it play in mitochondrial architecture?

FCJ1 (Formation of crista junctions protein 1) is a mitochondrial membrane protein that plays a critical role in determining mitochondrial inner membrane architecture. The protein is specifically enriched at crista junctions (CJs), which are tubular invaginations that connect the inner boundary membrane with the cristae membrane in mitochondria . These architectural elements are crucial for proper mitochondrial function. Studies have demonstrated that FCJ1 works antagonistically with subunits e and g of the F1FO ATP synthase to modulate CJ formation . In cells lacking FCJ1, CJs are absent, and concentric stacks of inner membrane appear in the mitochondrial matrix .

What is Paracoccidioides brasiliensis and why is FCJ1 important in this organism?

Paracoccidioides brasiliensis is a dimorphic fungal pathogen endemic to South America that causes paracoccidioidomycosis (PCM), a systemic mycosis affecting primarily the lungs . P. brasiliensis belongs to the genus Paracoccidioides, which comprises five recognized species: P. brasiliensis, P. lutzii, P. americana, P. restrepiensis, and P. venezuelensis . The study of FCJ1 in P. brasiliensis is significant because mitochondrial function and morphology are essential for fungal survival and pathogenicity. Understanding the role of FCJ1 in this organism may provide insights into its biology and potentially reveal targets for antifungal therapies.

How are crista junctions structured and why are they important for mitochondrial function?

Crista junctions (CJs) are narrow tubular- or slot-like structures that connect the inner boundary membrane with the cristae membrane in mitochondria . They serve as important structural elements that compartmentalize the inner mitochondrial membrane, creating distinct functional domains. CJs are critical for:

  • Regulating the distribution of proteins between the inner boundary membrane and cristae membrane

  • Controlling the diffusion of metabolites and ions

  • Influencing energy production efficiency

  • Maintaining proper organization of respiratory chain complexes

The architecture of CJs is determined by the interplay between FCJ1 and F1FO-ATP synthase oligomers . FCJ1 promotes CJ formation, while F1FO-ATP synthase oligomers stabilize the highly curved cristae tips . This antagonistic relationship locally modulates membrane curvature to generate the characteristic mitochondrial ultrastructure .

What domains of FCJ1 are essential for its function in mitochondria?

FCJ1 contains several domains that contribute to its function, with the C-terminal domain being particularly critical:

  • N-terminal domain: Contains a mitochondrial targeting sequence and a transmembrane segment. While the transmembrane segment is important for full functionality, its specific amino acid sequence is not critical .

  • Middle region: Contains coiled-coil domains that likely contribute to protein-protein interactions.

  • C-terminal domain (residues 473-540): The most conserved part of FCJ1 that is essential for its function. This domain:

    • Is crucial for the formation of stable crista junctions

    • Mediates interaction with the TOB/SAM complex

    • Facilitates homo-oligomerization of FCJ1

    • Is required for genetic interaction with subunit e of F1FO ATP synthase

Deletion of the C-terminal domain results in strong impairment of CJ formation, appearance of irregular and stacked cristae, and loss of functional interaction with the F1FO ATP synthase . Size exclusion chromatography of the purified C-terminal domain (FCJ1 473-540) revealed that it forms oligomeric complexes corresponding to tetramers to hexamers .

How does FCJ1 interact with other mitochondrial proteins to form functional complexes?

FCJ1 engages in multiple protein-protein interactions that are critical for its function in maintaining mitochondrial architecture:

  • Self-interaction: The C-terminal domain of FCJ1 mediates homotypic interactions, forming oligomeric complexes. Purified FCJ1 473-540 efficiently binds full-length FCJ1 from mitochondrial lysates, suggesting this domain plays a key role in the formation of homo-oligomers .

  • Interaction with TOB/SAM complex: FCJ1 interacts with Tob55 of the translocase of outer membrane β-barrel proteins (TOB/SAM) complex through its C-terminal domain . This interaction appears to stabilize CJs in close proximity to the outer membrane. The association of the TOB/SAM complex with contact sites depends on the presence of FCJ1 .

  • MICOS/MINOS/MitOS complex: FCJ1 is part of a large multisubunit complex variously named MICOS, MINOS, or MitOS that plays a central role in the formation of CJs and determining cristae morphology . This complex creates contact sites with the outer membrane by interacting with Ugo1, the TOB complex, and Tom40 .

  • Antagonistic relationship with F1FO ATP synthase: FCJ1 modulates CJ formation in an antagonistic manner to subunits e and g of the F1FO ATP synthase . This relationship is important for controlling membrane curvature to generate both CJs and cristae tips.

What methods are used to produce recombinant P. brasiliensis FCJ1 for research purposes?

The production of recombinant P. brasiliensis FCJ1 typically involves bacterial expression systems. Based on the methodologies described for related proteins :

  • Cloning: The FCJ1 gene or specific domains (such as the C-terminal domain) are cloned into expression vectors, often as fusion proteins with tags like glutathione S-transferase (GST) to facilitate purification.

  • Expression: The recombinant protein is expressed in bacterial systems like E. coli under controlled induction conditions.

  • Purification:

    • For GST-tagged proteins, purification involves binding to glutathione Sepharose beads

    • The recombinant protein may be cleaved from the GST moiety using specific proteases

    • Further purification might involve size exclusion chromatography to isolate specific oligomeric forms

  • Characterization: The purified protein is characterized by techniques such as SDS-PAGE, Western blotting, and size exclusion chromatography to determine purity, molecular weight, and oligomeric state .

Commercial sources now offer recombinant P. brasiliensis FCJ1 proteins for research purposes, including both full-length and partial variants .

What phenotypic changes occur when FCJ1 is deleted or overexpressed?

Experimental manipulation of FCJ1 expression leads to significant alterations in mitochondrial ultrastructure:

FCJ1 Deletion Effects:

  • Complete absence of crista junctions

  • Formation of concentric stacks of inner membrane in the mitochondrial matrix

  • Increased levels of F1FO-ATP synthase supercomplexes

  • Aberrant mitochondrial morphology

FCJ1 Overexpression Effects:

  • Increased formation of crista junctions

  • Branching of cristae

  • Enlargement of crista junction diameter

  • Reduced levels of F1FO-ATP synthase supercomplexes

These phenotypic changes demonstrate that FCJ1 is a critical determinant of cristae architecture, working antagonistically with F1FO-ATP synthase subunits e and g to control membrane curvature .

How is the interaction between FCJ1 and the TOB/SAM complex studied experimentally?

The interaction between FCJ1 and the TOB/SAM complex has been investigated using several complementary approaches:

  • Co-immunoprecipitation assays: Using antibodies against FCJ1 or TOB/SAM components to pull down protein complexes, followed by immunoblotting to detect interacting partners .

  • Pull-down experiments: The C-terminal domain of FCJ1 (residues 473-540) has been expressed and purified as a GST fusion protein, then used to capture binding partners from mitochondrial lysates .

  • Genetic interaction studies: Down-regulation of TOB/SAM complex components has been shown to lead to altered cristae morphology and a moderate reduction in the number of CJs, suggesting functional interaction with FCJ1 .

  • Electron microscopy: To visualize the effects of disrupting the FCJ1-TOB/SAM interaction on mitochondrial ultrastructure .

  • Deletion mutants: Creation of Fcj1 variants lacking specific domains (e.g., C-terminal domain) to identify regions required for interaction with the TOB/SAM complex .

Research suggests that the C-terminal domain of FCJ1 is critical for the interaction with the TOB/SAM complex, and this interaction helps stabilize CJs in close proximity to the outer membrane .

What is the relationship between FCJ1 function and pathogenicity in P. brasiliensis?

While direct studies linking FCJ1 to pathogenicity in P. brasiliensis are not detailed in the provided search results, several connections can be inferred:

  • Mitochondrial function and stress response: Proper mitochondrial architecture, which depends on FCJ1, is critical for energy production and stress response in fungi. Altered mitochondrial function may affect the ability of P. brasiliensis to adapt to the host environment.

  • Morphological transition: P. brasiliensis is a dimorphic fungus that undergoes a temperature-dependent morphological switch, which is crucial for pathogenicity . Mitochondrial function may play a role in this transition.

  • Immune response modulation: P. brasiliensis infection triggers specific immune responses, with different genotypes potentially eliciting different immune profiles . Mitochondrial proteins may contribute to pathogen-associated molecular patterns that influence host recognition.

  • Species-specific pathogenicity: Despite genetic variability among Paracoccidioides species, clinical presentations appear similar across infections with different species . This suggests that core pathogenicity mechanisms, potentially including mitochondrial functions, may be conserved.

Future research examining FCJ1 knockout or modified strains of P. brasiliensis in infection models would help elucidate the specific contribution of this protein to fungal pathogenicity.

What are the current challenges in studying FCJ1 in Paracoccidioides compared to model organisms?

Studying FCJ1 in Paracoccidioides presents several challenges compared to research in model organisms like Saccharomyces cerevisiae:

  • Genetic manipulation limitations: While robust genetic tools exist for yeast, manipulation of Paracoccidioides is more challenging due to:

    • Slower growth rates

    • More complex culture requirements

    • Less established transformation protocols

    • Limited availability of selectable markers

  • Dimorphic lifecycle: P. brasiliensis transitions between yeast and mycelial forms, complicating consistent experimental conditions and potentially affecting mitochondrial dynamics .

  • Biosafety considerations: As a pathogenic organism, P. brasiliensis requires higher containment levels, limiting some experimental approaches.

  • Genomic complexity: While Paracoccidioides is haploid like S. cerevisiae , the recent recognition of five distinct species complicates genetic analysis and requires careful strain selection.

  • Protein expression challenges: Production of recombinant Paracoccidioides proteins often requires heterologous expression systems, which may not perfectly recapitulate native protein modifications.

These challenges have led researchers to focus on comparative approaches, using knowledge gained from model organisms to inform studies in Paracoccidioides, and employing recombinant proteins to study specific functions in vitro.

How might new imaging technologies enhance our understanding of FCJ1 localization and dynamics?

Advanced imaging techniques could significantly enhance our understanding of FCJ1 localization and dynamics in P. brasiliensis:

  • Super-resolution microscopy: Techniques like STED, PALM, or STORM could reveal the precise localization of FCJ1 at crista junctions with nanometer resolution, beyond what conventional microscopy allows.

  • Correlative light and electron microscopy (CLEM): This approach could connect fluorescent protein-tagged FCJ1 localization with ultrastructural details of mitochondrial membranes.

  • Live-cell imaging: Using fluorescent protein fusions to monitor FCJ1 dynamics in real-time during different growth conditions or morphological transitions in P. brasiliensis.

  • Cryo-electron tomography: This technique could provide high-resolution 3D reconstructions of native mitochondrial membranes and FCJ1 complexes in situ.

  • Single-molecule tracking: These approaches could reveal the mobility and turnover rates of FCJ1 within mitochondrial membranes.

Implementation of these techniques would help bridge the gap between the detailed knowledge obtained in model organisms and our understanding of FCJ1 function in the pathogenically relevant Paracoccidioides species.

What potential exists for FCJ1 as a therapeutic target for antifungal development?

FCJ1 presents several characteristics that make it an interesting candidate for antifungal drug development:

  • Essential function: FCJ1's critical role in mitochondrial architecture suggests that its inhibition could significantly impair fungal viability.

  • Protein-protein interactions: The multiple protein-protein interactions mediated by FCJ1, particularly through its C-terminal domain, could provide specific sites for small molecule intervention.

  • Evolutionary divergence: Potential differences in FCJ1 between fungal pathogens and human homologs (mitofilin/IMMT) might allow for selective targeting.

  • Mitochondrial targeting: Compounds targeting mitochondrial proteins may achieve greater selectivity due to differences in mitochondrial uptake between fungi and host cells.

Research approaches to explore FCJ1 as a therapeutic target might include:

  • High-throughput screening for compounds that disrupt the interaction between FCJ1 and the TOB/SAM complex

  • Structure-based drug design targeting the conserved C-terminal domain

  • Peptide mimetics that interfere with FCJ1 oligomerization

  • Evaluation of mitochondrial morphology and function as readouts for FCJ1 inhibition

Given the importance of FCJ1 in mitochondrial architecture and the critical role of mitochondria in cellular energy production, targeting this protein could represent a novel approach to antifungal therapy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.