Recombinant Paracoccidioides brasiliensis High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant SHO1 is a full-length or partial protein expressed in Escherichia coli with an N-terminal histidine (His) tag for purification . It corresponds to the native High Osmolarity Signaling Protein SHO1 (UniProt IDs: C0S7Q7, C1GJ63) involved in fungal osmotic stress response pathways. These pathways enable P. brasiliensis to adapt to environmental changes, potentially influencing virulence and pathogenicity .

Production and Purification

Recombinant SHO1 is produced under standardized conditions:

ParameterSpecification
Expression SystemE. coli .
Purification MethodImmobilized metal affinity chromatography (IMAC) via His tag .
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer with trehalose .

Reconstitution Protocol:

  • Centrifuge vial before opening.

  • Resuspend in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term stability .

Genomic and Proteomic Context

  • Lineage-Specific Diversity: P. brasiliensis comprises distinct lineages (S1a, S1b, PS2, PS3, PS4), with SHO1 potentially varying in function across strains . For example, the S1b lineage (including strain Pb18) shows higher genetic diversity and recombination rates, which may influence SHO1’s role in stress adaptation .

  • Metabolic Pathways: Proteomic studies reveal that P. brasiliensis upregulates proteins linked to carbon metabolism, oxidative phosphorylation, and nucleotide synthesis under stress . While SHO1 is not directly highlighted, its signaling role likely intersects with these pathways.

Functional Studies

  • Osmosensing: SHO1 is hypothesized to activate mitogen-activated protein (MAP) kinase cascades under osmotic stress, akin to homologs in other fungi .

  • Virulence Modulation: Comparative genomics identifies positive selection in antigenic proteins (e.g., GP43, PGA1) and stress-response genes in P. brasiliensis, suggesting SHO1 could indirectly affect host immune evasion .

Future Research Directions

  1. Role in Pathogenicity: Investigate SHO1’s contribution to fungal survival in host tissues using knockout strains .

  2. Structural Analysis: Resolve 3D structures to map osmotic signal transduction mechanisms .

  3. Therapeutic Targeting: Explore SHO1 as a drug target to disrupt fungal adaptation during infection .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate your preference when placing the order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your use.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type will be decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SHO1; PABG_03857; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Paracoccidioides brasiliensis (strain Pb03)
Target Names
SHO1
Target Protein Sequence
MAQLDVNNIMGDPFALVTLSMAMIGWLLSLVTCVISDVQGIFPNYVWWAVTYMFVTIIGL AIVMGSQTSHVYAIAIVGYLAAGLCFTTLAVNSLVYDGSATKQAAAAGFILQSMVIIIWI FYFGSTPRSSTRGYLDHSGGAGNEHHSYRNSKPISNSYGRPETTVSGNQPPQMYTSAQLN GFETSTPIAGYPSTATDNPNNAGRFGQAPIGSQTNLTPGNNPVVGAGGISLGMGGATDPS NANEISQPTEYPYRAKAIYSYEANPDDANEISFAKHEILDVSDVSGRWWQAKKATGETGI APSNYLILL
Uniprot No.

Target Background

Function
Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Paracoccidioides brasiliensis and why is it significant for research?

Paracoccidioides brasiliensis is a temperature-dependent dimorphic fungal pathogen that causes systemic paracoccidioidomycosis, a granulomatous disease. This ascomycete exhibits a morphological transition, existing as mycelium at 22°C and as pathogenic yeast at 37°C (the virulent form) . This temperature-dependent dimorphism makes it an important model organism for studying fungal adaptation to host environments.

The significance of P. brasiliensis in research stems from several factors:

  • It represents a major endemic mycosis in Latin America

  • It serves as a model for studying fungal dimorphism mechanisms

  • It provides insights into fungal virulence factors and pathogenicity

  • Its cell signaling pathways, particularly the MAPK pathway, are crucial for understanding eukaryotic transcriptional control

What is the function of SHO1 protein in P. brasiliensis?

SHO1 (High Osmolarity Signaling protein) in P. brasiliensis functions as an osmosensor . Based on its homology to SHO1 proteins in other fungi, it likely plays a critical role in:

  • Signal transduction in response to environmental stresses, particularly osmotic stress

  • Activation of the High Osmolarity Glycerol (HOG) pathway

  • Cell wall integrity maintenance

  • Potential involvement in the dimorphic transition between yeast and mycelial forms

  • Mediating responses to oxidative stress, which is particularly important during host-pathogen interactions

SHO1 likely contributes to the fungal adaptive response against host defense mechanisms, similar to how other proteins like peroxiredoxins help P. brasiliensis counter the reactive oxygen species (ROS) produced by the host's immune response .

How is recombinant P. brasiliensis SHO1 protein produced?

The recombinant full-length SHO1 protein from P. brasiliensis is typically produced through heterologous expression in E. coli . The methodological approach includes:

  • Gene Cloning and Vector Construction:

    • PCR amplification of the SHO1 gene from P. brasiliensis genomic DNA

    • Insertion into an appropriate expression vector with an N-terminal His-tag

    • Verification of construct by sequencing

  • Protein Expression:

    • Transformation of E. coli with the expression construct

    • Induction of protein expression (typically using IPTG)

    • Optimization of expression conditions (temperature, induction time, media composition)

  • Protein Purification:

    • Cell lysis to release recombinant protein

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Further purification steps as needed (ion exchange, size exclusion chromatography)

    • Verification of purity by SDS-PAGE (>90% purity)

  • Post-purification Processing:

    • Concentration and buffer exchange

    • Lyophilization for long-term storage

What are the optimal storage and handling conditions for recombinant SHO1?

For optimal stability and activity, recombinant P. brasiliensis SHO1 protein requires specific storage and handling protocols :

  • Storage Recommendations:

    • Store lyophilized protein at -20°C to -80°C upon receipt

    • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution Protocol:

    • Centrifuge the vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% for long-term storage (50% is recommended)

  • Buffer Composition:

    • The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Trehalose acts as a stabilizing agent for the lyophilized protein

  • Handling Precautions:

    • Avoid repeated freeze-thaw cycles

    • Use sterile technique when handling the protein

    • Maintain cold chain during all handling procedures

    • Note that the protein is marked "Not For Human Consumption"

How might SHO1 contribute to P. brasiliensis pathogenicity?

SHO1 likely plays multiple roles in P. brasiliensis pathogenicity through several mechanisms:

  • Stress Response Regulation:

    • Similar to other fungal proteins like peroxiredoxins, SHO1 may contribute to the fungal antioxidant defense mechanisms against host immune response

    • It likely helps the pathogen cope with the oxidative burst generated by host macrophages

  • Dimorphic Transition:

    • As P. brasiliensis is a temperature-dependent dimorphic fungus, SHO1 may regulate signaling pathways involved in the transition from mycelium (22°C) to the virulent yeast form (37°C)

    • This morphological transition is essential for virulence

  • Cell Wall Integrity:

    • The localization of SHO1 likely includes the cell wall, similar to other P. brasiliensis proteins like PbPrx1

    • Cell wall proteins are often directly involved in host-pathogen interactions

  • MAPK Pathway Activation:

    • By functioning in the MAPK signaling cascade, SHO1 potentially regulates virulence gene expression

    • The MAPK pathway is a major mechanism for controlling transcription in eukaryotes, including pathogenicity-related genes

  • Adaptation to Host Environment:

    • The osmosensing function of SHO1 would help the fungus adapt to the osmotic conditions within the host

    • This adaptation is crucial for fungal survival and proliferation during infection

What experimental approaches are optimal for studying SHO1 protein interactions?

To effectively study SHO1 protein interactions in P. brasiliensis, researchers can employ multiple complementary approaches:

  • Yeast Two-Hybrid (Y2H) Analysis:

    • Using SHO1 as bait to screen for interacting proteins

    • Verification of interactions through targeted Y2H assays

    • Mapping interaction domains through truncation mutants

  • Co-immunoprecipitation (Co-IP):

    • Using anti-SHO1 antibodies to pull down protein complexes

    • Mass spectrometry analysis of co-precipitated proteins

    • Western blot verification of specific interactions

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fusion of potential interacting partners with complementary fragments of fluorescent proteins

    • Visualization of interactions in living cells

    • Analysis of subcellular localization of interaction events

  • Surface Plasmon Resonance (SPR):

    • Quantitative measurement of binding kinetics using purified recombinant proteins

    • Determination of binding affinities (Kd values)

    • Analysis of the effects of mutations on binding properties

  • Proximity-dependent Biotin Identification (BioID):

    • Fusion of SHO1 with a biotin ligase

    • Identification of proximal proteins through streptavidin pulldown and mass spectrometry

    • Mapping the SHO1 protein interaction network in different conditions

  • Comparative Analysis with Other Fungi:

    • Study SHO1 interactions known in related fungi like Candida albicans or Saccharomyces cerevisiae

    • Identification of conserved and divergent interaction partners

How does SHO1 function in the MAPK signaling pathway of P. brasiliensis?

SHO1 likely plays a crucial role in the MAPK signaling pathway of P. brasiliensis, based on what is known about MAPK pathways in fungi :

  • Initiating Signal Transduction:

    • As a membrane sensor, SHO1 likely detects environmental signals (particularly osmotic changes)

    • Transmembrane domains allow SHO1 to transmit external signals to internal signaling machinery

  • Scaffold Function:

    • SHO1 likely serves as a scaffold protein that recruits and organizes MAPK cascade components

    • This scaffolding function enhances signaling efficiency and specificity

  • MAPK Cascade Activation:

    • Upon stimulation, SHO1 likely activates MAPKKK (MAP kinase kinase kinase)

    • This triggers the phosphorylation cascade: MAPKKK → MAPKK → MAPK

  • Integration with Other Pathways:

    • SHO1 may integrate signals from multiple sources

    • Cross-talk between the HOG pathway and other MAPK pathways could be mediated by SHO1

  • Transcriptional Regulation:

    • The activated MAPK pathway leads to transcription factor activation

    • This regulates genes involved in stress response, morphogenesis, and virulence

Analysis of the P. brasiliensis genome has revealed components of the MAPK pathways , and understanding SHO1's specific interactions with these components would provide insights into the unique aspects of signal transduction in this pathogen.

What techniques are most effective for studying SHO1 localization in P. brasiliensis?

Based on successful localization studies of other P. brasiliensis proteins like PbPrx1 , several complementary techniques would be effective for studying SHO1 localization:

  • Confocal Microscopy:

    • Generation of monospecific antibodies against recombinant SHO1

    • Immunofluorescence labeling of fixed cells

    • Co-staining with markers for specific cellular compartments (e.g., Calcofluor White for cell wall)

    • Comparison between yeast and mycelial forms to detect form-specific localization

  • Fluorescence-Activated Cell Sorting (FACS):

    • Analysis of non-permeabilized cells to detect surface-exposed SHO1

    • Quantitative assessment of protein abundance at the cell surface

    • Comparison with preimmune controls to ensure specificity

  • Subcellular Fractionation and Western Blotting:

    • Isolation of distinct cellular compartments (cell wall, mitochondria, cytosol)

    • Western blot analysis using anti-SHO1 antibodies

    • Comparison between different morphological forms (yeast vs. mycelium)

  • GFP Fusion Proteins:

    • Generation of SHO1-GFP fusion constructs

    • Expression in P. brasiliensis using appropriate transformation methods

    • Live-cell imaging to track protein localization dynamically

  • Immunoelectron Microscopy:

    • Ultra-structural localization at high resolution

    • Gold-labeled antibodies to precisely identify SHO1 position within cellular structures

  • Extracellular Vesicle Analysis:

    • Isolation of extracellular vesicles from P. brasiliensis cultures

    • Western blot and proteomic analysis to determine if SHO1 is secreted via vesicles, similar to PbPrx1

How can functional assays be designed to evaluate SHO1's role in osmotic stress response?

To evaluate SHO1's functional role in osmotic stress response, researchers can implement these methodological approaches:

  • Gene Knockout/Knockdown Studies:

    • CRISPR-Cas9 or RNAi-mediated reduction of SHO1 expression

    • Analysis of growth and survival under osmotic stress conditions

    • Complementation with wild-type SHO1 to confirm phenotype specificity

  • Phosphorylation Cascade Analysis:

    • Exposure of cells to osmotic stress (e.g., high salt, sorbitol)

    • Western blot analysis with phospho-specific antibodies for MAPK pathway components

    • Comparison between wild-type and SHO1-deficient strains

  • Transcriptional Response Profiling:

    • RNA-seq analysis following osmotic stress in the presence/absence of SHO1

    • Identification of SHO1-dependent gene expression changes

    • Comparison with known osmotic stress response genes

  • Protein-Protein Interaction Dynamics:

    • Co-immunoprecipitation under normal and osmotic stress conditions

    • Analysis of stress-induced changes in SHO1 interaction partners

    • Identification of condition-specific protein complexes

  • Microscopic Analysis of Morphological Changes:

    • Time-lapse microscopy during osmotic challenge

    • Quantification of cell wall changes, volume regulation, and morphological adaptations

    • Comparison between SHO1-expressing and SHO1-deficient strains

  • Heterologous Complementation:

    • Expression of P. brasiliensis SHO1 in S. cerevisiae SHO1 mutants

    • Assessment of functional conservation through rescue experiments

    • Analysis of species-specific functional differences

How does SHO1 from P. brasiliensis compare with homologs in other pathogenic fungi?

A comprehensive comparative analysis of SHO1 across different fungal species reveals both conserved and divergent features:

  • Sequence Conservation:

    • Similar to how P. brasiliensis PbPrx1 shows high homology with isoforms from Histoplasma capsulatum (89% identity) and Blastomyces dermatitidis (87% identity) , SHO1 likely exhibits significant conservation among thermally dimorphic fungi

    • Specific domains involved in sensing and signaling are expected to be highly conserved

  • Functional Divergence:

    • Despite sequence similarity, functional specialization may exist

    • Similar to how PbPrx1 shows higher affinity for organic hydroperoxides compared to hydrogen peroxide , SHO1 may have evolved pathogen-specific sensitivities to environmental signals

  • Subcellular Localization Differences:

    • In Candida albicans, certain proteins show differential localization between morphological forms (e.g., cytosol/nucleus in yeast cells vs. cell wall in hyphal phase)

    • SHO1 localization may similarly vary between fungal species or morphological forms

  • Signaling Pathway Integration:

    • The position of SHO1 within MAPK cascades may differ between species

    • Cross-talk with other signaling pathways could be species-specific

  • Evolutionary Considerations:

    • Phylogenetic analysis could reveal whether SHO1 evolution correlates with pathogenicity

    • Identification of positive selection signatures may highlight regions important for host adaptation

What are promising research directions for developing antifungal strategies targeting SHO1?

Considering SHO1's potential role in pathogenicity, several strategic research directions could lead to novel antifungal approaches:

  • Structure-Based Drug Design:

    • Determination of SHO1 three-dimensional structure

    • Identification of druggable pockets and interfaces

    • Virtual screening and molecular docking of compound libraries

  • Peptide Inhibitors:

    • Design of peptides that mimic SHO1 interaction interfaces

    • Development of cell-penetrating inhibitory peptides

    • Assessment of inhibition efficacy in vitro and in vivo

  • Signaling Pathway Disruption:

    • Identification of critical nodes in the SHO1-mediated signaling cascade

    • Screening for small molecules that disrupt specific protein-protein interactions

    • Evaluation of pathway-specific inhibitors in infection models

  • Host-Pathogen Interface Targeting:

    • If SHO1 is exposed at the cell surface, development of antibody-based therapeutics

    • Assessment of immunotherapeutic approaches targeting SHO1

    • Investigation of SHO1's role in host immune evasion

  • Combination Therapy Approaches:

    • Testing synergistic effects between SHO1 inhibitors and conventional antifungals

    • Investigation of multi-target approaches affecting related stress response pathways

    • Development of resistance-mitigating treatment regimens

  • Translational Research:

    • Screening of existing approved drugs for off-target effects on SHO1 signaling

    • Repurposing of compounds with established safety profiles

    • Accelerated development pathway through drug repurposing

These research directions will contribute to our understanding of P. brasiliensis pathogenicity while potentially yielding novel therapeutic strategies against paracoccidioidomycosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.