Recombinant Paracoccidioides brasiliensis Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are flexible to accommodate specific format requests. Please indicate your desired format in the order notes for personalized fulfillment.
Lead Time
Delivery timelines may vary based on the purchasing method and location. Kindly consult your local distributor for precise delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please communicate this in advance for additional fee considerations.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, centrifuge the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference point. Customers may adjust this according to their specific needs.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Typically, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms exhibit a longer shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquotting is recommended. Avoid repeated freeze-thaw cycles to maintain product integrity.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is determined during production, we welcome specific tag requests. We will prioritize development of the specified tag if provided.
Synonyms
LCL3; PABG_06163; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Paracoccidioides brasiliensis (strain Pb03)
Target Names
LCL3
Target Protein Sequence
MRWLFWSSGSQQAPNSNKDNNNNNDGDDDNNNIIINNINRRPPLTLECPSPSHPPCASCS TKATTSPSNPKRGWNTSLTARDWAGEFKDPRNLIPTLLLTGGILFCVRIHRQYLRRIPLA TNISPTYFHKRSLFGRVTSVGDGDNFRMYHTPGGRLAGWEWLPFRRVPRVKKELKDRTIH IRLAGIDAPELPHFGRPAQPYSHAAHTWLTNYLLNKRVRAFPYRQDQYGRVVATVYVRRF PWIFLRRDVGLQMLRAGMATVYEAKSGVEFGGEGKESKYRRAEEMAKRRGRGLWKGWKGA GWESPREYKNRMAGVEGERAAAGGGGGGVGGMGELGVNGGKN
Uniprot No.

Target Background

Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What heterologous expression systems are most effective for producing recombinant P. brasiliensis proteins?

Saccharomyces cerevisiae has proven to be an effective heterologous expression system for P. brasiliensis proteins. This model organism offers several advantages including ease of genetic manipulation, well-established transformation protocols using methods such as lithium acetate transformation, and the availability of various auxotrophic markers for selection (like URA3). The functional analysis of P. brasiliensis proteins, such as the Pb14-3-3 protein, has been successfully performed using S. cerevisiae as an expression system, allowing researchers to explore protein function in a controlled genetic background .

For recombinant protein expression, S. cerevisiae vectors like pYES2 have been used successfully. This system allows for inducible expression and has been applied to express full-length ORFs of P. brasiliensis proteins. The molecular cloning typically involves amplification of the target gene from P. brasiliensis cDNA, followed by cloning into the expression vector and transformation into appropriate S. cerevisiae strains .

What are the key considerations when designing primers for cloning P. brasiliensis genes?

When designing primers for cloning P. brasiliensis genes, several factors should be considered:

  • Codon optimization: P. brasiliensis has different codon usage preferences compared to model organisms. For example, when expressing Pb14-3-3 in S. cerevisiae, researchers must consider codon bias differences.

  • Inclusion of appropriate restriction sites: Primers should incorporate restriction enzyme sites compatible with the chosen expression vector while ensuring these sites do not occur within the gene of interest.

  • Inclusion/exclusion of signal sequences: Depending on the experimental goals, you might want to include or exclude native signal peptides. The gp43 gene, for instance, encodes a protein with a leader peptide of 35 amino acids that should be considered when designing expression constructs .

  • Addition of purification tags: Consider incorporating sequences for affinity tags (His, GST, etc.) to facilitate purification of the recombinant protein.

  • Consideration of introns: Some P. brasiliensis genes contain introns that may need to be excluded when cloning from cDNA. For example, the gp43 gene has been found to contain a structure with two exons and one intron .

How can the adhesive properties of recombinant P. brasiliensis proteins be evaluated?

Adhesion properties of recombinant P. brasiliensis proteins can be evaluated through several methodological approaches:

  • Cell adhesion assays: Quantitative adherence assays using mammalian cell lines, particularly pneumocytes or epithelial cells, can be performed. For example, with the Pb14-3-3 protein, researchers measured adhesion to pneumocytes by comparing the adhesion rates of S. cerevisiae transformants expressing Pb14-3-3 versus control transformants. This method allowed researchers to observe that Pb14-3-3 significantly increased the adhesion rate when expressed in wild-type S. cerevisiae .

  • Binding assays with extracellular matrix (ECM) components: Direct binding of recombinant proteins to ECM components like laminin and fibronectin can be assessed through ELISA-type assays. The Pb14-3-3 protein has been shown to bind to laminin, contributing to its role in P. brasiliensis-host interaction .

  • Inhibition assays: Pre-incubation of host cells with the recombinant protein followed by fungal infection can help determine if the protein can inhibit fungal adhesion by competing for binding sites. Studies have shown that recombinant Pb14-3-3 can decrease the adhesion rate of P. brasiliensis to epithelial cells, suggesting it competes for adhesion sites .

  • Heterologous expression systems: Expressing the protein of interest in non-pathogenic yeasts like S. cerevisiae and evaluating changes in adhesion properties can provide insights into the protein's function as an adhesin .

What approaches can be used to determine if a P. brasiliensis protein like endonuclease LCL3 contributes to pathogenicity?

Several experimental approaches can be employed to assess the contribution of a P. brasiliensis protein to pathogenicity:

  • Heterologous expression and functional complementation: Express the protein in model organisms (e.g., S. cerevisiae) and assess if it confers new properties related to virulence. For Pb14-3-3, researchers observed that it could partially complement the functions of homologous proteins in S. cerevisiae and alter susceptibility to antifungal compounds .

  • Gene expression analysis during infection: Evaluate the expression patterns of the gene during host-pathogen interaction. Upregulation during infection may suggest a role in pathogenicity. Studies with Pb14-3-3 have shown upregulation during infection in both P. brasiliensis and P. lutzii species .

  • Protein localization studies: Determine if the protein localizes to the cell wall or is secreted during infection, suggesting direct involvement in host interaction. The Pb14-3-3 protein has been shown to accumulate in the fungal cell wall during infection in both in vitro and in vivo models .

  • In vitro and in vivo infection models: Assess the effect of recombinant protein treatment on host cells or the impact of protein neutralization on infection outcomes. Studies have demonstrated that pneumocytes treated with Pb14-3-3 exhibit apoptosis signaling similar to that observed during P. brasiliensis infection .

  • Metabolic pathway analysis: Investigate the protein's involvement in metabolic pathways that might contribute to virulence. For instance, Pb14-3-3 has been shown to influence the ergosterol biosynthesis pathway, which is critical for fungal cell membrane integrity and antifungal resistance .

How does the probable endonuclease LCL3 compare functionally with other characterized P. brasiliensis virulence factors?

When comparing probable endonuclease LCL3 with other characterized P. brasiliensis virulence factors, researchers should consider several aspects:

  • Role in host-pathogen interaction: Several P. brasiliensis proteins function as adhesins, including the 43 kDa glycoprotein (gp43), glyceraldehyde-3-phosphate-dehydrogenase (GAPDH), enolase (ENO), and the 14-3-3 protein. These proteins assist in fungal adherence to host tissues by binding to components of the extracellular matrix (ECM) .

  • Multifunctionality: Many P. brasiliensis virulence factors exhibit multiple functions. For example, the 14-3-3 protein not only acts as an adhesin but also influences ergosterol biosynthesis, potentially affecting antifungal susceptibility. Similarly, many metabolic enzymes (GAPDH, ENO, etc.) serve dual roles in both metabolism and pathogenicity .

  • Conservation and specificity: When developing therapeutic targets, it's important to consider the conservation of the protein across species. The gp43 ortholog in P. lutzii, for instance, contains few epitopes in common with P. brasiliensis gp43, contributing to diagnostic challenges .

  • Immunomodulatory effects: Some P. brasiliensis proteins can modify host immune responses. The gp43 protein elicits an IFN-γ-mediated T-CD4+ response that is protective against lung infection by P. brasiliensis .

What are the challenges and methodological approaches for studying antifungal resistance mechanisms involving P. brasiliensis proteins?

Researchers studying antifungal resistance mechanisms involving P. brasiliensis proteins face several challenges and can employ various methodological approaches:

  • Ergosterol pathway analysis: Since many antifungals target ergosterol biosynthesis, studying proteins that influence this pathway is crucial. Real-time PCR can be used to evaluate the expression of genes involved in the ergosterol pathway (ERG1, ERG11, ERG28, HES1) when the protein of interest is expressed or silenced .

  • Antifungal susceptibility testing: Comparing the minimum inhibitory concentration (MIC) of antifungals against wild-type fungi versus strains with altered expression of the protein of interest. For example, S. cerevisiae transformants expressing Pb14-3-3 showed decreased susceptibility to fluconazole compared to controls .

  • Drug interaction studies: Investigating how the protein of interest might interact with antifungal compounds or influence their cellular targets. Pb14-3-3 has been shown to influence ergosterol biosynthesis, which is the target of azole antifungals like fluconazole .

  • Expression analysis under drug pressure: Evaluating how expression of the gene changes in response to antifungal treatment can provide insights into its role in resistance mechanisms.

Experimental data comparing gene expression in S. cerevisiae transformed with Pb14-3-3 versus controls has shown significant upregulation of ergosterol pathway genes:

GeneExpression Fold Change in WT S. cerevisiae + Pb14-3-3Expression Fold Change in Δbmh1 S. cerevisiae + Pb14-3-3
ERG1Significantly increasedSignificantly increased
ERG11IncreasedIncreased
ERG28Significantly increasedSignificantly increased
HES1Significantly increasedSignificantly increased

This upregulation contributes to decreased antifungal susceptibility and highlights the potential role of P. brasiliensis proteins in drug resistance mechanisms .

What are the optimal conditions for expressing and purifying recombinant P. brasiliensis proteins from heterologous systems?

When expressing and purifying recombinant P. brasiliensis proteins from heterologous systems, researchers should consider:

  • Expression system selection: S. cerevisiae has proven effective for expressing P. brasiliensis proteins while maintaining functional properties. The selection of appropriate strains is crucial - wild-type and single mutant S. cerevisiae strains can be used, as demonstrated with Pb14-3-3 expression .

  • Vector choice: Inducible expression vectors like pYES2 allow controlled expression of potentially toxic proteins. These vectors typically use auxotrophic markers (e.g., URA3) for selection of transformants .

  • Growth conditions: Optimizing temperature, media composition, and induction conditions is essential. For S. cerevisiae expressing P. brasiliensis proteins, growth on SD-URA (synthetic defined medium without uracil) followed by induction in galactose-containing media has been effective .

  • Protein extraction methods: Cell disruption methods should be optimized based on the cellular localization of the expressed protein. For cell wall-associated proteins, specialized extraction methods may be required.

  • Purification strategy: Adding affinity tags (His, GST) can facilitate purification while preserving protein function. Chromatographic techniques should be selected based on the protein's biochemical properties.

  • Functional validation: After purification, confirming the functionality of the recombinant protein through appropriate assays is essential. For adhesins like Pb14-3-3, adhesion assays with mammalian cells can verify functionality .

How can researchers effectively study protein-protein interactions involving P. brasiliensis proteins?

Studying protein-protein interactions involving P. brasiliensis proteins requires multiple complementary approaches:

  • Yeast two-hybrid (Y2H) assays: These can identify potential protein partners by expressing the P. brasiliensis protein as a bait and screening against prey libraries. This approach is particularly useful for discovering novel interactions.

  • Co-immunoprecipitation (Co-IP): Using antibodies against the protein of interest to pull down interaction partners from fungal lysates, followed by mass spectrometry identification. This method preserves native interactions.

  • Pull-down assays with recombinant proteins: Immobilizing purified recombinant proteins on a solid support and incubating with cell lysates to capture interaction partners. This approach has been used to study interactions between P. brasiliensis adhesins and host ECM components .

  • Surface plasmon resonance (SPR): Quantifying binding kinetics and affinity between the recombinant protein and potential partners. This provides detailed information about interaction strength and dynamics.

  • Fluorescence resonance energy transfer (FRET): Tagging potential interaction partners with appropriate fluorophores and measuring energy transfer as an indication of proximity. This can be used to study interactions in living cells.

  • Computational approaches: Using protein structure prediction and docking simulations to identify potential interaction interfaces. This is especially useful when experimental data is limited.

  • Functional complementation studies: Expressing P. brasiliensis proteins in model organisms with mutations in homologous genes can indicate functional conservation through protein interaction networks. The partial complementation of S. cerevisiae Bmh1p and Bmh2p functions by Pb14-3-3 suggests conservation of certain protein-protein interactions .

What are the recommended approaches for analyzing the structural and functional relationships of P. brasiliensis proteins?

For analyzing structural and functional relationships of P. brasiliensis proteins, researchers should consider:

  • Sequence alignment and phylogenetic analysis: Comparing protein sequences with homologs from other species to identify conserved domains and predict function. Analysis of Pb14-3-3 showed higher identity with Bmh2p than with Bmh1p from S. cerevisiae, correlating with functional complementation results .

  • Structural prediction and modeling: Using computational tools to predict protein structure based on amino acid sequence and homology to proteins with known structures. For proteins like the probable endonuclease LCL3, structural models can provide insights into catalytic domains.

  • Domain mapping through truncation mutants: Creating a series of truncated versions of the protein to identify functional domains. This approach can pinpoint regions responsible for specific activities, such as adhesion.

  • Site-directed mutagenesis: Introducing specific mutations in conserved residues to assess their importance for protein function. This is particularly useful for studying catalytic sites in enzymes.

  • X-ray crystallography or NMR spectroscopy: These techniques provide high-resolution structural information but require significant amounts of purified protein. The structural data can be correlated with functional assays to understand structure-function relationships.

  • Protein-ligand interaction studies: Using techniques like isothermal titration calorimetry (ITC) or SPR to characterize binding to potential substrates or inhibitors.

  • Cross-species functional analysis: Expressing the P. brasiliensis protein in other fungal species to assess functional conservation, as demonstrated with Pb14-3-3 expression in S. cerevisiae .

How can transcriptomic and proteomic approaches enhance our understanding of P. brasiliensis protein function during host-pathogen interactions?

Integrative transcriptomic and proteomic approaches offer powerful insights into P. brasiliensis protein function during host-pathogen interactions:

  • Differential expression analysis: RNA-seq can identify genes upregulated during infection, highlighting potential virulence factors. The Pb14-3-3 gene has been shown to be upregulated during interaction with mice in both P. brasiliensis and P. lutzii .

  • Secretome analysis: Proteomic analysis of proteins secreted during infection can identify extracellular proteins involved in host interaction. Pb14-3-3 has been identified in P. brasiliensis extracellular vesicles, suggesting a role in the secretome .

  • Host response profiling: Analyzing host cell transcriptional responses to specific fungal proteins can reveal their effects on host physiology. Pneumocytes treated with Pb14-3-3 exhibit apoptosis signaling similar to that observed during P. brasiliensis infection .

  • Time-course experiments: Studying expression patterns at different stages of infection can reveal the temporal dynamics of protein function. The accumulation of Pb14-3-3 in the fungal cell wall during infection has been observed in both in vitro and in vivo models .

  • Comparative analysis across strains: Comparing the expression profiles of different Paracoccidioides species can highlight conserved virulence mechanisms. Studies have shown that Pb14-3-3 is upregulated in both P. brasiliensis and P. lutzii during host interaction .

  • Pathway enrichment analysis: Identifying biological pathways altered during infection can contextualize protein function. Pb14-3-3 has been shown to influence ergosterol biosynthesis pathway genes, suggesting a role in membrane integrity and antifungal resistance .

  • Interactome mapping: Using proteomics to identify protein-protein interactions during infection can reveal functional networks. This approach can place proteins like the probable endonuclease LCL3 in the context of broader virulence mechanisms.

What are the key considerations for developing targeted therapeutics against P. brasiliensis proteins?

When developing targeted therapeutics against P. brasiliensis proteins, researchers should consider:

The multifunctional nature of Pb14-3-3 and its involvement in both adhesion and ergosterol biosynthesis make it a particularly promising therapeutic target against Paracoccidioides spp. .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.