Recombinant Paracoccidioides brasiliensis Protein GET1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET1; PAAG_04380; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) (Paracoccidioides brasiliensis)
Target Names
GET1
Target Protein Sequence
MPSLLISVLFLHIAIYIINTIGASTIDSLLWLIYTKLPTSASCMAREQHQMKLEVVQLKR EMNATSSQDEFAKWAKLRRRHDKALEEYEVKNKQFSRFKSLFDVAVKALRWAGTSGLILL LQFWFSKTPIFTLPPSWIPWQVEWVLSFPRAPMGTVSIQVWGGACAVMVALVGEAIGATV RYLYGSKDSMEAIKVGAGAVEKEKKRQ
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. It functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of P. brasiliensis proteins in fungal pathogenesis?

Proteins from P. brasiliensis play critical roles in the pathogen's life cycle and host-pathogen interactions. Many P. brasiliensis proteins exhibit dual functionality, as exemplified by paracoccin, which possesses both lectin properties (carbohydrate-binding activity) and enzymatic capabilities (N-acetylglucosaminidase activity) . These multifunctional proteins contribute to fungal growth, morphogenesis, and interaction with host cells and tissues . The lectin domain enables binding to host components like laminin in a sugar recognition-dependent manner, facilitating adhesion to host tissues, while enzymatic activities may contribute to cell wall remodeling during morphological transitions . Understanding these proteins provides insights into virulence mechanisms and potential targets for therapeutic intervention.

How are P. brasiliensis species classified and how does this affect protein studies?

The Paracoccidioides genus was initially considered a single species but has been reclassified based on molecular analysis. Current classification includes the P. brasiliensis species complex (comprising phylogenetic groups S1, PS2, and PS3) and P. lutzii as a separate species . This classification is based on analysis of multiple genetic loci, including chitin synthase, β-glucan synthase, α-tubulin, and the GP43 gene . This genetic diversity significantly impacts protein studies, as proteins may exhibit structural and functional variations across species. For example, researchers noted serological immunodiagnostic challenges in patients from Midwestern Brazil infected with P. lutzii compared to those infected with P. brasiliensis species complex, indicating antigenic differences between the species . When studying recombinant proteins, researchers must clearly identify the source strain and its phylogenetic classification to ensure appropriate interpretation of results.

What approaches have been used to identify and characterize P. brasiliensis proteins?

Several complementary approaches have been employed to identify and characterize P. brasiliensis proteins:

  • Genomic and transcriptomic analyses: The EST sequencing project characterized the functional genome of P. lutzii (Pb01 isolate), leading to the sequencing of 6022 genes differentially expressed between mycelial and yeast forms .

  • Proteomic studies: These have identified proteins like paracoccin and linked them to specific gene sequences (e.g., PADG-3347 for paracoccin) .

  • Recombinant protein expression: Cloning and expression of genes in heterologous systems like E. coli has enabled functional characterization of proteins .

  • Functional assays: For instance, paracoccin was characterized through binding assays (laminin binding), enzymatic activity tests (N-acetylglucosaminidase activity), and immunological studies (macrophage stimulation) .

  • Differential gene expression analysis: Techniques like cDNA Representational Difference Analysis (cDNA-RDA) have identified genes required for specific processes, such as dissemination via hematogenic routes .

What expression systems are most effective for P. brasiliensis proteins?

Expression SystemAdvantagesChallengesSuitable For
E. coliRapid growth, high yields, cost-effectiveInclusion body formation, limited post-translational modificationsProteins without complex modifications
Yeast systemsEukaryotic modifications, proper foldingLower yields, longer production timeProteins requiring glycosylation
Mammalian cellsNative-like modificationsExpensive, complex maintenanceProteins with critical mammalian-specific modifications

For paracoccin, two different approaches were employed in E. coli:

  • The largest exon (rPCN exon4) yielded soluble protein that could be purified directly

  • The full multi-exon assembly (rPCN full) resulted in inclusion bodies requiring solubilization and refolding

This difference highlights how protein complexity affects expression outcomes even within the same system.

What cloning and expression strategies optimize yield and activity of recombinant P. brasiliensis proteins?

Based on the recombinant paracoccin production described in the literature, several strategies can optimize yield and activity:

  • Gene construct design:

    • Using the predicted mRNA transcript sequence for oligonucleotide design

    • Considering both full-length genes and individual exons/domains

    • Appropriate fusion tags (e.g., GST tag used for rPCN exon4)

  • Expression optimization:

    • Codon optimization for the host system

    • Induction conditions (temperature, IPTG concentration, duration)

    • Culture media composition

  • Inclusion body management:

    • For proteins forming inclusion bodies (like rPCN full), effective solubilization methods (e.g., urea treatment)

    • Controlled refolding protocols to restore native structure and function

  • Activity preservation:

    • Selection of purification methods that preserve biological activity

    • Verification that refolded proteins retain native functions

The successful expression and purification of active recombinant paracoccin demonstrates that with appropriate strategies, functional P. brasiliensis proteins can be produced in heterologous systems.

What purification approaches yield the highest purity and activity for P. brasiliensis recombinant proteins?

Purification strategies should be tailored to the specific properties of the target protein. From studies with recombinant paracoccin, two effective approaches have been documented:

  • Affinity tag-based purification:

    • For GST-tagged rPCN exon4: Glutathione-sepharose 4B affinity chromatography with elution using reduced glutathione

    • This yielded a single 48-kDa band (22-kDa protein plus 26-kDa GST tag) on SDS-PAGE

  • Functional domain-based purification:

    • For refolded rPCN full: GlcNAc affinity chromatography exploiting the protein's natural carbohydrate-binding ability

    • This resulted in a single 28-kDa band on SDS-PAGE

Key considerations for successful purification include:

  • Leveraging natural binding properties where possible

  • Selecting appropriate buffer conditions to maintain stability

  • Verifying that purified proteins retain both immunological identity with native proteins and their biological activities

For multi-domain proteins, it's essential to ensure that the purification process preserves the structure-function relationships critical for biological activity.

How can researchers verify the structural and functional integrity of recombinant P. brasiliensis proteins?

Multiple complementary approaches should be employed to confirm that recombinant proteins retain the structural and functional properties of their native counterparts:

  • Structural verification:

    • SDS-PAGE for molecular weight confirmation

    • Western blotting with antibodies against the native protein (anti-paracoccin IgY recognized both recombinant forms)

    • Circular dichroism or other spectroscopic methods for secondary structure analysis

  • Functional verification through activity assays:

    • Binding assays: For paracoccin, verification of laminin binding in a carbohydrate recognition-dependent manner

    • Enzymatic activity: N-acetylglucosaminidase activity assays for paracoccin

    • Cell-based assays: Stimulation of murine peritoneal macrophages to produce TNF-α and nitric oxide

  • In vivo validation:

    • Animal models to confirm biological activity (e.g., protection assays in mouse models of paracoccidioidomycosis)

The comprehensive characterization of recombinant paracoccin demonstrates how multiple approaches collectively confirm that a recombinant protein faithfully reproduces the properties of its native counterpart.

What experimental approaches best demonstrate the immunomodulatory effects of P. brasiliensis proteins?

Based on studies with recombinant paracoccin, several approaches effectively demonstrate immunomodulatory effects:

  • In vitro immune cell stimulation:

    • Culture of peritoneal macrophages with the recombinant protein

    • Measurement of inflammatory mediators (TNF-α, nitric oxide)

    • Assessment of cell surface activation markers

  • Cytokine profiling:

    • Quantification of pro-inflammatory (TNF-α, IL-12, IFN-γ) and anti-inflammatory (IL-10) cytokines

    • Analysis of Th1/Th2/Th17 balance in response to protein stimulation

  • In vivo immunomodulation studies:

    • Different administration protocols (timing relative to fungal challenge)

    • Assessment of immune response through cytokine levels in tissues

    • Correlation with disease outcomes (fungal burden, granuloma formation)

  • Mechanistic investigations:

    • Identification of cellular receptors engaged by the protein

    • Signaling pathways activated upon protein recognition

For recombinant paracoccin, these approaches revealed that it induces a protective Th1 immune response balanced by IL-10 production, explaining its protective effect in experimental paracoccidioidomycosis .

How can researchers assess the potential therapeutic applications of recombinant P. brasiliensis proteins?

Assessment of therapeutic potential requires a systematic approach that evaluates both efficacy and mechanism of action:

Assessment ApproachMethodologyOutcome MeasuresExample from Literature
Prophylactic administrationMultiple administration schedules tested pre-infectionFungal burden, tissue pathologyrPCN reduced fungal burden when administered 3 days pre-challenge
Therapeutic administrationAdministration after established infectionDisease regression, survivalTo be tested with recombinant proteins
Immune response characterizationCytokine profiling in tissuesTh1/Th2/Th17 balance, IL-10 levelsrPCN induced Th1 immunity balanced by IL-10
Comparative efficacyComparison with established treatmentsRelative efficacy to standard therapiesrPCN effects similar to P10 vaccine
Safety assessmentHistopathology, inflammatory markersTissue damage, inflammatory balancerPCN prevented tissue damage through balanced inflammation

For recombinant paracoccin, prophylactic administration conferred protection against PCM in mice, associated with a balanced Th1 response. The pattern of disease in treated mice resembled that of mice receiving other vaccine candidates like P10, suggesting potential as an immunotherapeutic agent .

How do multi-domain structures affect recombinant P. brasiliensis protein functions?

P. brasiliensis proteins often contain multiple domains with distinct but complementary functions. Studies with paracoccin provide insights into these structure-function relationships:

  • Domain-specific activities:

    • Lectin domain: Responsible for carbohydrate binding (specifically N-acetylglucosamine) and interactions with host components like laminin

    • Enzymatic domain: Exhibits N-acetylglucosaminidase activity, similar to family 18 endochitinases

  • Domain interdependence:

    • When the largest exon (rPCN exon4) was expressed separately, it retained some functions (laminin binding, induction of inflammatory mediators) but lacked N-acetylglucosaminidase activity

    • The full protein (rPCN full) reproduced all activities of the native protein

  • Functional implications:

    • The multi-domain nature explains diverse biological activities: influence on fungal growth, interaction with host extracellular matrix, and immunomodulation

    • Complete protein structure appears necessary for full enzymatic activity, suggesting domain interactions contribute to enzyme function

These observations highlight the importance of considering domain structure when designing recombinant constructs and interpreting functional data.

What challenges arise in translating in vitro findings to in vivo applications for P. brasiliensis recombinant proteins?

Translating in vitro findings to in vivo applications presents several challenges that researchers must address:

  • Administration protocol optimization:

    • For recombinant paracoccin, different administration schedules were tested

    • Injection three days before fungal challenge proved most effective, inducing balanced immunity

  • Immune response complexity:

    • In vitro findings (e.g., macrophage activation) don't fully predict in vivo immune responses

    • The balance between protective immunity (Th1) and anti-inflammatory components (IL-10) is crucial for effective protection without tissue damage

  • Dosage and delivery considerations:

    • Determining optimal dose for efficacy without adverse effects

    • Selecting appropriate administration routes for targeted delivery

  • Strain variation effects:

    • Genetic diversity within the Paracoccidioides genus may affect protein structure and function

    • Efficacy against different strains must be evaluated for broadly applicable therapies

  • Host factor influences:

    • Individual variations in immune response

    • Comorbidities that may alter protein efficacy or safety

The successful use of recombinant paracoccin in a mouse model of PCM demonstrates that these challenges can be overcome with systematic investigation and careful protocol optimization .

How can genomic and transcriptomic approaches enhance recombinant P. brasiliensis protein research?

Genomic and transcriptomic analyses provide valuable insights that can enhance recombinant protein research:

  • Gene identification and characterization:

    • EST sequencing projects identified genes differentially expressed between mycelial and yeast forms

    • This helped identify proteins involved in phase transition and adaptation to host conditions

  • Strain-specific variations:

    • Molecular analysis revealed genetic diversity within Paracoccidioides species

    • Understanding these variations helps interpret strain-specific protein functions

  • Expression pattern insights:

    • cDNA-RDA identified genes required for dissemination via hematogenic routes

    • This helps prioritize proteins for recombinant expression based on their role in pathogenesis

  • Structural predictions:

    • Genomic data enables prediction of protein domains and functional motifs

    • For paracoccin, sequence analysis revealed similarity to family 18 endochitinases with distinct lectin and enzymatic domains

  • Target selection for recombinant expression:

    • Transcriptomic data identifies highly expressed genes during infection

    • This guides selection of proteins likely to be important in host-pathogen interactions

These approaches have accelerated the understanding of P. brasiliensis biology and guided the selection of proteins like paracoccin for recombinant expression and functional characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.