Recombinant Paracoccus denitrificans ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Pden_2879; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Paracoccus denitrificans (strain Pd 1222)
Target Names
atpB
Target Protein Sequence
MAEEEAGGLVFHPMDQFVIKPLFGEGPVNWYTPTNATLWMALAALAITALLVFGTRGRAI VPNRVQSIAELLYGMVHKMVEDVTGKDGLKYFPYVMTLFCFILFANFLGLLPKSFSPTSH IAVTAVLAVLVFAGVTVLGFVKNGAHFLGLFWVSSAPLALRPVLAVIELISYFVRPVSHS IRLAGNIMAGHAVIKVFAAFAAVAAIAPVSVVAITAMYGLEVLVCLIQAYVFTILTCVYL KDALHPAH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of subunit a (atpB) in P. denitrificans ATP synthase compared to other bacterial species?

Subunit a (atpB) in P. denitrificans forms a critical component of the membrane-bound FO domain, providing an essential pathway for proton translocation through the ATP synthase complex. Unlike some other bacterial ATP synthases, the P. denitrificans enzyme demonstrates unique regulatory features, including strong inhibition of ATP hydrolysis activity while maintaining efficient ATP synthesis . The FO domain containing subunit a participates in coupling proton movement to the rotary mechanism that drives ATP synthesis through conformational changes induced in the F1 domain . This makes subunit a particularly significant for understanding the directional bias observed in P. denitrificans ATP synthase compared to more reversible bacterial ATP synthases like those from E. coli.

How does the expression system affect the functional properties of recombinant P. denitrificans subunit a?

When expressing recombinant P. denitrificans subunit a, researchers must consider that expression conditions significantly impact proper membrane insertion and folding. Studies have demonstrated that recombinant atpB requires specific chaperones and membrane environments to achieve native conformation. Expression in heterologous systems often requires optimization of induction conditions, temperature, and membrane-mimetic environments to preserve function. Bacterial expression systems (particularly E. coli) have been used, but they require careful optimization of membrane targeting sequences and solubilization strategies, as improper folding can lead to non-functional protein that fails to integrate properly into the ATP synthase complex during reconstitution experiments .

What purification methods yield the highest activity for recombinant P. denitrificans subunit a?

Optimal purification of recombinant P. denitrificans subunit a requires specialized approaches:

Purification StepKey ParametersConsiderations
Initial Extraction0.1-0.5% Detergent (LDAO or DDM)Lower detergent concentrations preserve native structure
Column ChromatographyNi-NTA (for His-tagged variants)pH 7.5-8.0 optimizes binding while minimizing aggregation
Size ExclusionSuperdex 200 in detergent bufferSeparates monomeric from aggregated forms
Lipid Reconstitution4:1 lipid:protein ratioCritical for functional studies

How can researchers effectively measure the functional integration of recombinant subunit a into the ATP synthase complex?

To confirm functional integration of recombinant subunit a into the ATP synthase complex, researchers should employ multiple complementary approaches:

  • ATP synthesis assays: Measure ATP production in reconstituted vesicles under proton gradient conditions. Functional incorporation should support ATP synthesis rates comparable to native enzyme (typically 200-300 nmol/min/mg protein under optimal conditions) .

  • Proton translocation measurements: Using pH-sensitive fluorescent dyes (ACMA or pyranine) to monitor proton movement across membranes containing reconstituted ATP synthase with the recombinant subunit a.

  • Inhibitor sensitivity tests: Properly incorporated subunit a confers specific sensitivity to inhibitors like venturicidin that target the FO domain . Comparative inhibition profiles between wild-type and reconstituted systems provide evidence for correct incorporation.

  • Rotational analysis: Advanced biophysical techniques can confirm whether reconstituted complexes containing recombinant subunit a maintain the characteristic 3×120° rotary mechanism observed in P. denitrificans F1-ATPase .

For quantitative assessment, researchers should compare ATP synthesis rates between reconstituted systems and native P. denitrificans membrane vesicles, with successful incorporation typically achieving at least 70-80% of native activity.

What are the optimal conditions for studying the interaction between subunit a and the ζ subunit in P. denitrificans ATP synthase?

The interaction between subunit a and the ζ inhibitory subunit represents a critical area of research in understanding P. denitrificans ATP synthase regulation. Optimal conditions for studying these interactions include:

  • Cross-linking studies: Zero-length or short-distance cross-linkers can identify proximity relationships between subunit a and ζ within the intact complex.

  • Membrane environment: Studies should be conducted in phospholipid compositions that mimic the native P. denitrificans membrane environment, typically with a mixture of phosphatidylcholine, phosphatidylethanolamine, and cardiolipin at a 7:2:1 ratio.

  • Energization conditions: Since the interaction may be dependent on the energization state, studies should compare conditions with and without respiratory substrates like NADH (typically at 0.2-0.5 mM) .

Research indicates that the ζ subunit's inhibitory function depends on specific conformational states of the ATP synthase complex, suggesting potential indirect interactions with the proton-conducting apparatus that includes subunit a . Investigating whether mutations in subunit a affect ζ-mediated inhibition would provide valuable insights into the regulatory cross-talk between different domains of the enzyme.

How does the membrane environment affect the function of recombinant subunit a in P. denitrificans ATP synthase?

The membrane environment critically influences subunit a function through several mechanisms:

Membrane FactorEffect on Subunit a FunctionExperimental Evidence
Phospholipid CompositionAffects proton conductance efficiencyActivity varies by 30-50% with different lipid compositions
Membrane FluidityImpacts conformational flexibilityTemperature-dependent activity shifts suggest membrane-mediated effects
Proton GradientEssential for proper functionEnergy-dependent transformation observed only under specific Δμ(H+) conditions
Lateral PressureInfluences subunit packingReconstitution efficiency varies with lipid:protein ratios

Research demonstrates that P. denitrificans ATP synthase exhibits unique energy-dependent transformations in its activity profile, with the membrane environment playing a crucial role in this regulation . For functional studies of recombinant subunit a, researchers should reconstitute the protein into liposomes with lipid compositions that mimic the bacterial inner membrane, maintain appropriate lateral pressure through careful lipid:protein ratios, and establish defined proton gradients to assess functionality.

How do mutations in conserved residues of subunit a affect the directional bias of P. denitrificans ATP synthase?

P. denitrificans ATP synthase exhibits a strong directional bias favoring synthesis over hydrolysis, partially attributed to the ζ subunit but potentially involving structural elements of subunit a as well . Research on conserved residues in subunit a reveals:

  • Arginine residues in the proton channel: Mutations in conserved arginine residues (particularly those corresponding to R210 in E. coli) dramatically alter proton translocation efficiency and can modify the directional bias.

  • Interface residues: Amino acids at the interface between subunit a and the c-ring influence the energy threshold required for rotation, potentially contributing to directional preference.

  • Membrane-facing residues: Mutations affecting interaction with the lipid environment can alter conformational flexibility, impacting the energy landscape for rotation in different directions.

Studies comparing wild-type and subunit a mutants show that specific mutations can partially alleviate the strong inhibition of ATP hydrolysis observed in P. denitrificans, suggesting that subunit a contributes to the directional bias beyond the effects attributed to the ζ subunit . The mechanistic basis involves subtle changes in proton conductance pathways that create asymmetric energy barriers for forward versus reverse rotation.

What biophysical techniques are most effective for studying the proton translocation pathway in recombinant P. denitrificans subunit a?

Advanced biophysical techniques for studying proton translocation in recombinant subunit a include:

  • Site-directed spin labeling combined with EPR spectroscopy: This approach can map conformational changes associated with proton movement through strategic placement of spin labels at positions surrounding predicted proton-conducting channels.

  • Hydrogen/deuterium exchange mass spectrometry (HDX-MS): Provides insights into solvent accessibility and structural dynamics of regions involved in proton translocation under different energization conditions.

  • Solid-state NMR: Can resolve specific protonation states of key residues within the membrane environment, particularly when combined with isotopic labeling strategies.

  • Single-molecule FRET: By labeling specific positions in subunit a and adjacent subunits, conformational changes associated with proton movement can be monitored in real-time.

Recent research has demonstrated that P. denitrificans F1-ATPase possesses a simplified chemomechanical scheme different from other F1-ATPases , suggesting unique features in its proton translocation pathway that warrant detailed biophysical investigation using these techniques.

How does the evolutionary relationship between P. denitrificans ATP synthase and mitochondrial ATP synthase influence subunit a function?

P. denitrificans ATP synthase shows remarkable evolutionary relationships with mitochondrial ATP synthase, with important implications for subunit a function:

  • Sequence homology: P. denitrificans subunit a shares higher sequence similarity with mitochondrial ATP synthase than with most other bacterial homologs, suggesting conservation of key functional elements.

  • Inhibitory mechanisms: The presence of the ζ subunit in P. denitrificans mimics mitochondrial IF1 inhibition mechanisms , potentially influencing how subunit a participates in regulation.

  • Structural adaptations: Subtle differences in subunit a structure may accommodate the specific regulatory proteins evolved in each system while maintaining core proton translocation functions.

Research indicates that P. denitrificans F1-ATPase exhibits structural and functional features bridging typical bacterial and mitochondrial ATP synthases , making it valuable for evolutionary studies. The conservation of specific residues in subunit a correlates with the presence of ζ-like inhibitory proteins across α-proteobacteria , suggesting co-evolution of regulatory mechanisms involving subunit a.

What are the best expression systems for obtaining functional recombinant P. denitrificans subunit a?

Expression of functional recombinant P. denitrificans subunit a requires careful consideration of several factors:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
E. coli C41(DE3)Membrane protein specialized strainPotential improper folding0.5-1.5
P. denitrificans (homologous)Native membrane environmentLower yields, complex genetics0.2-0.7
Cell-free systemsControl over membrane mimeticsHigher cost, technical complexity0.1-0.4

The most successful approach combines optimized E. coli expression (typically using specialized strains like C41(DE3) or C43(DE3)) with careful membrane isolation and reconstitution protocols. Key considerations include:

  • Induction conditions: Lower induction temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.3 mM) favor proper folding over high expression levels.

  • Membrane targeting: Including native signal sequences or fusion partners that facilitate membrane insertion improves functional yield.

  • Extraction protocols: Gentle solubilization using mild detergents preserves structural integrity during purification.

For functional studies, expression systems that enable co-expression with other ATP synthase subunits may provide advantages for proper complex assembly and stability.

How can researchers distinguish between direct effects of subunit a mutations and indirect effects on ζ subunit binding?

Distinguishing direct mutational effects in subunit a from indirect effects on ζ subunit interaction requires carefully designed experiments:

  • Sequential reconstitution: Reconstituting ATP synthase complexes with and without the ζ subunit allows researchers to isolate subunit a effects independent of ζ-mediated inhibition.

  • Binding assays: Direct binding measurements between recombinant ζ and ATP synthase complexes containing wild-type or mutant subunit a can quantify affinity changes resulting from mutations.

  • Kinetic analysis: Comparing ATP synthesis and hydrolysis rates under different energization conditions can separate effects on catalytic efficiency from those on regulatory interactions.

  • Cross-linking studies: Site-specific cross-linking between subunit a variants and ζ can map interaction interfaces and detect structural perturbations.

Research shows that while ζ subunit deletion increases ATP hydrolysis activity in P. denitrificans, the increase remains modest compared to other bacterial ATP synthases , suggesting multiple layers of regulation involving both ζ and structural elements potentially including subunit a.

What reconstitution methods provide the most reliable functional assessment of recombinant P. denitrificans subunit a?

For reliable functional assessment of recombinant subunit a, researchers should consider these reconstitution methods:

  • Co-reconstitution with purified ATP synthase subunits: Combining individually purified subunits (including recombinant subunit a) into liposomes allows precise control over complex composition.

  • Hybrid complex formation: Reconstituting recombinant subunit a into ATP synthase depleted of native subunit a creates chimeric complexes for functional assessment.

  • Complementation in membrane vesicles: Adding recombinant subunit a to membrane vesicles from subunit a-depleted cells tests functional integration in a near-native environment.

The most reliable approach combines detergent-mediated reconstitution with functional assays measuring both ATP synthesis and proton translocation. Successful reconstitution should restore venturicidin sensitivity , proton pumping capability, and ATP synthesis activity. The reconstitution efficiency can be verified by comparing activity rates with those of native P. denitrificans membrane vesicles, where properly reconstituted complexes typically achieve 70-90% of native activity levels.

How can researchers reconcile contradictory findings about the role of subunit a in P. denitrificans ATP synthase regulation?

Contradictory findings regarding subunit a's role in regulation can be addressed through systematic analysis:

  • Experimental condition standardization: Different energization states dramatically affect P. denitrificans ATP synthase activity , so standardizing membrane energization conditions is essential for comparing results across studies.

  • Integrated analysis: Combining structural, biochemical, and biophysical data provides a more complete picture than any single approach. For example, studies showing minimal effect of ζ deletion on ATP hydrolysis should be interpreted alongside energization-dependent activity studies .

  • Isolation of variables: Testing the effects of subunit a mutations in both ζ-containing and ζ-deleted backgrounds helps separate direct effects from regulatory interactions.

Research indicates that P. denitrificans ATP synthase regulation involves multiple mechanisms, including the ζ inhibitory protein , energy-dependent conformational changes , and potentially structural elements of subunit a. This multi-layered regulation explains apparent contradictions in the literature, where different experimental approaches may preferentially detect specific regulatory mechanisms.

What control experiments are essential when studying the function of recombinant P. denitrificans subunit a?

Essential control experiments include:

  • Inhibitor sensitivity profiles: Venturicidin specifically targets the FO domain including subunit a . Comparing inhibitor sensitivity between native and reconstituted systems confirms proper integration of recombinant subunit a.

  • Proton leakage controls: Passive proton permeability measurements ensure that observed proton movements reflect ATP synthase activity rather than membrane defects.

  • ATP synthesis/hydrolysis ratio: P. denitrificans ATP synthase exhibits a distinctive bias toward synthesis over hydrolysis . This ratio serves as a functional fingerprint for properly assembled complexes.

  • ATPase activation controls: Treatment with LDAO (0.15%) selectively activates the F1 domain , providing a benchmark for maximal activity independent of subunit a function.

  • Energization-dependent activity: The characteristic energy-dependent transformation of P. denitrificans ATP synthase serves as an essential control for functional reconstitution.

These controls help distinguish genuine effects of recombinant subunit a from artifacts related to improper assembly, membrane integrity issues, or non-native conformational states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.