Recombinant Paracoccus denitrificans Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Primary Function

mscL acts as a safety valve during osmotic stress, releasing ions (e.g., K⁺, glutamate) to prevent cell lysis . Its activation depends on lateral membrane tension rather than extracellular pressure .

Chemical and Pharmacological Modulators

CompoundMechanismEffect on mscL Activity
DihydrostreptomycinBinds near TM pockets, causing partial pore opening Efflux of ions and antibiotic entry
RamizolReduces gating threshold (in silico screening) Inhibits growth in Staphylococcus aureus
SCH-79797Binds S1-TM2 interface, activating the channel Membrane permeabilization; effective against drug-resistant strains
CurcuminIndirect activation; increases channel activity Growth inhibition in mscL-dependent pathways

Antibiotics like SCH-79797 exploit mscL’s absence in eukaryotes, positioning it as a novel antimicrobial target .

Research Applications

  1. Mechanosensation Studies:

    • Lipid Interactions: Mutational and HDX-MS/ESEEM experiments reveal lipid acyl chains occupy TM pockets, stabilizing the closed state .

    • Gating Dynamics: Spin-labeling (e.g., MTSSL) tracks conformational changes during mechanosensation .

  2. Antimicrobial Development:

    • DHS and Ramizol: Demonstrate proof-of-concept for targeting mscL in pathogens .

    • SCH-79797 Derivatives: Show efficacy in infection models, bypassing traditional antibiotic resistance mechanisms .

  3. Membrane Biophysics:

    • Reconstitution Systems: Artificial liposomes validate functional integrity post-purification .

    • Channel Inhibitors: Gadolinium blocks mscL activity, confirming mechanosensitive specificity .

Key Research Findings

  • Structural Insights: Archaeal MscL structures (e.g., Thermobifida fusca) inform gating models, though the open state remains unresolved .

  • Functional Degeneracy: Coexistence with the glyoxylate cycle in P. denitrificans suggests metabolic flexibility under stress .

  • Pharmacological Potential: mscL’s role in bacterial survival under osmotic stress positions it for therapeutic targeting .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
mscL; Pden_2265; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Paracoccus denitrificans (strain Pd 1222)
Target Names
mscL
Target Protein Sequence
MFKEFKEFIARGNVIDLAVGIIIGAAFTAIVNSLVADLINPIIGLLTGGTDFSGHYLVLK GEVPPGASLQVARDSGASVFAYGAFLSAVINFLIIAWAVFLLVKAVNRVQSAASRQKEAE AEAAAGPTQEELLTEIRDELRARRT
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.